Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Vasoactive intestinal polypeptide receptor 2 (VIPR2) Recombinant Protein | VIPR2 recombinant protein

Recombinant Human Vasoactive intestinal polypeptide receptor 2 (VIPR2)

Gene Names
VIPR2; VPAC2; VPAC2R; VIP-R-2; VPCAP2R; PACAP-R3; DUP7q36.3; PACAP-R-3; C16DUPq36.3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vasoactive intestinal polypeptide receptor 2 (VIPR2); Recombinant Human Vasoactive intestinal polypeptide receptor 2 (VIPR2); Recombinant Vasoactive intestinal polypeptide receptor 2 (VIPR2); Vasoactive intestinal polypeptide receptor 2; VIP-R-2; Helodermin-preferring VIP receptor Pituitary adenylate cyclase-activating polypeptide type III receptor; PACAP type III receptor; PACA; VIPR2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-438
Sequence
ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQFHRGSRAQSFLQTETSVI
Sequence Length
438
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,479 Da
NCBI Official Full Name
vasoactive intestinal polypeptide receptor 2
NCBI Official Synonym Full Names
vasoactive intestinal peptide receptor 2
NCBI Official Symbol
VIPR2
NCBI Official Synonym Symbols
VPAC2; VPAC2R; VIP-R-2; VPCAP2R; PACAP-R3; DUP7q36.3; PACAP-R-3; C16DUPq36.3
NCBI Protein Information
vasoactive intestinal polypeptide receptor 2; PACAP type III receptor; VIP and PACAP receptor 2; helodermin-preferring VIP receptor; pituitary adenylate cyclase-activating polypeptide type III receptor
UniProt Protein Name
Vasoactive intestinal polypeptide receptor 2
UniProt Gene Name
VIPR2
UniProt Synonym Gene Names
VIP2R; VIP-R-2; PACAP type III receptor; PACAP-R-3; PACAP-R3
UniProt Entry Name
VIPR2_HUMAN

NCBI Description

This gene encodes a receptor for vasoactive intestinal peptide, a small neuropeptide. Vasoactive intestinal peptide is involved in smooth muscle relaxation, exocrine and endocrine secretion, and water and ion flux in lung and intestinal epithelia. Its actions are effected through integral membrane receptors associated with a guanine nucleotide binding protein which activates adenylate cyclase. [provided by RefSeq, Aug 2011]

Uniprot Description

VIPR2: This is a receptor for VIP as well as PACAP-38 and -27, the activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Can be coupled to phospholipase C. Belongs to the G-protein coupled receptor 2 family.

Protein type: GPCR, family 2; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 7q36.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; vasoactive intestinal polypeptide receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; cell-cell signaling; negative regulation of smooth muscle cell proliferation; adenylate cyclase activation; signal transduction

Research Articles on VIPR2

Similar Products

Product Notes

The VIPR2 vipr2 (Catalog #AAA955440) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-438. The amino acid sequence is listed below: ECRFHLEIQE EETKCAELLR SQTEKHKACS GVWDNITCWR PANVGETVTV PCPKVFSNFY SKAGNISKNC TSDGWSETFP DFVDACGYSD PEDESKITFY ILVKAIYTLG YSVSLMSLAT GSIILCLFRK LHCTRNYIHL NLFLSFILRA ISVLVKDDVL YSSSGTLHCP DQPSSWVGCK LSLVFLQYCI MANFFWLLVE GLYLHTLLVA MLPPRRCFLA YLLIGWGLPT VCIGAWTAAR LYLEDTGCWD TNDHSVPWWV IRIPILISII VNFVLFISII RILLQKLTSP DVGGNDQSQY KRLAKSTLLL IPLFGVHYMV FAVFPISISS KYQILFELCL GSFQGLVVAV LYCFLNSEVQ CELKRKWRSR CPTPSASRDY RVCGSSFSRN GSEGALQFHR GSRAQSFLQT ETSVI. It is sometimes possible for the material contained within the vial of "Vasoactive intestinal polypeptide receptor 2 (VIPR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.