Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tetraspanin-6 (TSPAN6) Recombinant Protein | TSPAN6 recombinant protein

Recombinant Human Tetraspanin-6 (TSPAN6)

Gene Names
TSPAN6; T245; TM4SF6; TSPAN-6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tetraspanin-6 (TSPAN6); Recombinant Human Tetraspanin-6 (TSPAN6); TSPAN6 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-245aa; Full length protein
Sequence
MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKN SFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKL EDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for TSPAN6 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,563 Da
NCBI Official Full Name
tetraspanin-6 isoform d
NCBI Official Synonym Full Names
tetraspanin 6
NCBI Official Symbol
TSPAN6
NCBI Official Synonym Symbols
T245; TM4SF6; TSPAN-6
NCBI Protein Information
tetraspanin-6
UniProt Protein Name
Tetraspanin-6
UniProt Gene Name
TSPAN6
UniProt Synonym Gene Names
TM4SF6; Tspan-6
UniProt Entry Name
TSN6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The protein encoded by this gene is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2 protein. It functions as a negative regulator of retinoic acid-inducible gene I-like receptor-mediated immune signaling via its interaction with the mitochondrial antiviral signaling-centered signalosome. This gene uses alternative polyadenylation sites, and multiple transcript variants result from alternative splicing. [provided by RefSeq, Jul 2013]

Uniprot Description

TSPAN6: is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]

Protein type: Motility/polarity/chemotaxis; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq22

Cellular Component: integral to plasma membrane

Molecular Function: protein binding; signal transducer activity

Biological Process: cell surface receptor linked signal transduction; positive regulation of I-kappaB kinase/NF-kappaB cascade

Research Articles on TSPAN6

Similar Products

Product Notes

The TSPAN6 tspan6 (Catalog #AAA7032305) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-245aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the TSPAN6 tspan6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASPSRRLQT KPVITCFKSV LLIYTFIFWI TGVILLAVGI WGKVSLENYF SLLNEKATNV PFVLIATGTV IILLGTFGCF ATCRASAWML KLYAMFLTLV FLVELVAAIV GFVFRHEIKN SFKNNYEKAL KQYNSTGDYR SHAVDKIQNT LHCCGVTDYR DWTDTNYYSE KGFPKSCCKL EDCTPQRDAD KVNNEGCFIK VMTIIESEMG VVAGISFGVA CFQLIGIFLA YCLSRAITNN QYEIV. It is sometimes possible for the material contained within the vial of "Tetraspanin-6 (TSPAN6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.