Transcriptional enhancer factor TEF-3 (TEAD4) Recombinant Protein | TEAD4 recombinant protein

Recombinant Chicken Transcriptional enhancer factor TEF-3 (TEAD4)

Cat. Num. AAA717693

• Gene Names: TEAD4; TEF-1; TEF-3; RTEF-1; TEAD-4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transcriptional enhancer factor TEF-3 (TEAD4); Recombinant Chicken Transcriptional enhancer factor TEF-3 (TEAD4); TEAD4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-438, Full length protein
• Sequence: MTSEWSSPASPEGSNDSGGSEALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKKTQVDKYDFSSEKDQTAKDKAMQSIATMSSAQIISATAFHSKMALPGLPRSAYPAVSGFWQGALPGQAGSSQDVKPFTQQPYALQPSLPLPGFDSPTGLPPSSSTPAWQGRRVASSKLWMLEFSAFLEQQQDQDTYNKHLFVHIGQSNPSYSDPYLEAVDIRQIYDKFPEKKGGLKELFERGPANAFFLVKFWADLNTNIEDESRSFYGVSSQYESPENMVITCSTKVCSFGKQVVEKVETEYAHYENGHYAYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASDHGAQHHIYRLVKD
• Sequence Length: 438

• Species: Chicken
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for TEAD4 recombinant protein

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA
ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 51558711
• NCBI GeneID: 395542
• NCBI Accession #: NP_001001337.1
• NCBI GenBank Nucleotide #: NM_001001337.1
• UniProt Accession #: P48984
• Molecular Weight: 34,729 Da
• NCBI Official Full Name: transcriptional enhancer factor TEF-3 isoform 1
• NCBI Official Synonym Full Names: TEA domain transcription factor 4
• NCBI Official Symbol: TEAD4
• NCBI Official Synonym Symbols: TEF-1; TEF-3; RTEF-1; TEAD-4
• NCBI Protein Information: transcriptional enhancer factor TEF-3
• UniProt Protein Name: Transcriptional enhancer factor TEF-3
• Protein Family: Transcriptional enhancer factor
• UniProt Gene Name: TEAD4
• UniProt Synonym Gene Names: TEF-1; TEF3; TEAD-4

NCBI Description

This gene encodes a transcription factor which is a member of the transcriptional enhancer factor (TEF) family. Members of this family are characterized by a TEA/ATTS DNA-binding domain. This factor, which is highly expressed in muscle, binds to a promoter element called M-CAT, a motif found in promoters of muscle specific genes. Alternatively spliced transcripts encoding distinct isoforms, which are encoded through the use of a non-AUG (UUG) translation initiation codon, have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ (). Binds m-cat elements from muscle-specific promoters and differentially activate transcription.