Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Transcription initiation factor TFIID subunit 5 (TAF5) Recombinant Protein | TAF5 recombinant protein

Recombinant Human Transcription initiation factor TFIID subunit 5 (TAF5)

Gene Names
TAF5; TAF2D; TAFII100; TAFII-100; TAF(II)100
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription initiation factor TFIID subunit 5 (TAF5); Recombinant Human Transcription initiation factor TFIID subunit 5 (TAF5); TAF5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-800, Full length protein
Sequence
MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ
Sequence Length
800
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for TAF5 recombinant protein
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes an integral subunit of TFIID associated with all transcriptionally competent forms of that complex. This subunit interacts strongly with two TFIID subunits that show similarity to histones H3 and H4, and it may participate in forming a nucleosome-like core in the TFIID complex.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80,508 Da
NCBI Official Full Name
transcription initiation factor TFIID subunit 5 isoform 1
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 5
NCBI Official Symbol
TAF5
NCBI Official Synonym Symbols
TAF2D; TAFII100; TAFII-100; TAF(II)100
NCBI Protein Information
transcription initiation factor TFIID subunit 5
UniProt Protein Name
Transcription initiation factor TFIID subunit 5
UniProt Gene Name
TAF5
UniProt Synonym Gene Names
TAF2D; TAF(II)100; TAFII-100; TAFII100

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes an integral subunit of TFIID associated with all transcriptionally competent forms of that complex. This subunit interacts strongly with two TFIID subunits that show similarity to histones H3 and H4, and it may participate in forming a nucleosome-like core in the TFIID complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription. TAF5/TAFII100 interacts strongly with the histone H4-related TAF6/TAFII80 and the histone H3-related TAF9/TAFII31, as well as a stable complex comprised of both TAF5/TAFII80 and TAF6/TAFII31. Apparently weaker interactions of TAF5/TAFII100 with TBP, TAF1/TAFII250, TAF11/TAFII28, and TAF12/TAFII20, but not TAF7/TAFII55, also have been observed.

Research Articles on TAF5

Similar Products

Product Notes

The TAF5 taf5 (Catalog #AAA1372779) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-800, Full length protein. The amino acid sequence is listed below: MAALAEEQTE VAVKLEPEGP PTLLPPQAGD GAGEGSGGTT NNGPNGGGGN VAASSSTGGD GGTPKPTVAV SAAAPAGAAP VPAAAPDAGA PHDRQTLLAV LQFLRQSKLR EAEEALRREA GLLEEAVAGS GAPGEVDSAG AEVTSALLSR VTASAPGPAA PDPPGTGASG ATVVSGSASG PAAPGKVGSV AVEDQPDVSA VLSAYNQQGD PTMYEEYYSG LKHFIECSLD CHRAELSQLF YPLFVHMYLE LVYNQHENEA KSFFEKFHGD QECYYQDDLR VLSSLTKKEH MKGNETMLDF RTSKFVLRIS RDSYQLLKRH LQEKQNNQIW NIVQEHLYID IFDGMPRSKQ QIDAMVGSLA GEAKREANKS KVFFGLLKEP EIEVPLDDED EEGENEEGKP KKKKPKKDSI GSKSKKQDPN APPQNRIPLP ELKDSDKLDK IMNMKETTKR VRLGPDCLPS ICFYTFLNAY QGLTAVDVTD DSSLIAGGFA DSTVRVWSVT PKKLRSVKQA SDLSLIDKES DDVLERIMDE KTASELKILY GHSGPVYGAS FSPDRNYLLS SSEDGTVRLW SLQTFTCLVG YKGHNYPVWD TQFSPYGYYF VSGGHDRVAR LWATDHYQPL RIFAGHLADV NCTRFHPNSN YVATGSADRT VRLWDVLNGN CVRIFTGHKG PIHSLTFSPN GRFLATGATD GRVLLWDIGH GLMVGELKGH TDTVCSLRFS RDGEILASGS MDNTVRLWDA IKAFEDLETD DFTTATGHIN LPENSQELLL GTYMTKSTPV VHLHFTRRNL VLAAGAYSPQ. It is sometimes possible for the material contained within the vial of "Transcription initiation factor TFIID subunit 5 (TAF5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.