Transcription initiation factor TFIID subunit 12 (Taf12) Recombinant Protein | Taf12 recombinant protein
Recombinant Mouse Transcription initiation factor TFIID subunit 12 (Taf12)
Gene Names
Taf12; 20kDa; Taf2J; AW557038; 2810422D08Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription initiation factor TFIID subunit 12 (Taf12); Recombinant Mouse Transcription initiation factor TFIID subunit 12 (Taf12); Taf12 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-161, full length protein
Sequence
MNQFGPSALINLSSFSSVKPEPASTPPQGSMANSTTVGKIAGTPGTGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
Sequence Length
161
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Taf12 recombinant protein
Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Two transcript variants encoding the same protein have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
17,875 Da
NCBI Official Full Name
transcription initiation factor TFIID subunit 12
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 12
NCBI Official Symbol
Taf12
NCBI Official Synonym Symbols
20kDa; Taf2J; AW557038; 2810422D08Rik
NCBI Protein Information
transcription initiation factor TFIID subunit 12
UniProt Protein Name
Transcription initiation factor TFIID subunit 12
Protein Family
UniProt Gene Name
Taf12
UniProt Synonym Gene Names
TAFII-20; TAFII20
Uniprot Description
TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription ().
Research Articles on Taf12
Similar Products
Product Notes
The Taf12 taf12 (Catalog #AAA1338855) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-161, full length protein. The amino acid sequence is listed below: MNQFGPSALI NLSSFSSVKP EPASTPPQGS MANSTTVGKI AGTPGTGGRL SPENNQVLTK KKLQDLVREV DPNEQLDEDV EEMLLQIADD FIESVVTAAC QLARHRKSST LEVKDVQLHL ERQWNMWIPG FGSEEIRPYK KACTTEAHKQ RMALIRKTTK K. It is sometimes possible for the material contained within the vial of "Transcription initiation factor TFIID subunit 12 (Taf12), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
