Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Prostaglandin G/H synthase 1 (Ptgs1) Recombinant Protein | Ptgs1 recombinant protein

Recombinant Rat Prostaglandin G/H synthase 1 (Ptgs1)

Gene Names
Ptgs1; Cox1; Cox3; Cox-1; Cox-3; Pghs-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prostaglandin G/H synthase 1 (Ptgs1); Recombinant Rat Prostaglandin G/H synthase 1 (Ptgs1); Ptgs1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-602, full length protein
Sequence
TDAGVPSPVNPCCYYPCQNQGVCVRFGLDHYQCDCTRTGYSGPNCTIPEIWTWLRSSLRPSPSFTHFLLTHGYWIWEFVNATFIREVLMRLVITVRSNLIPSPPTYNTAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDIHLLAQRLLLRREFIPGPQGTNVLFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDSLERQYHLRLFKDGKLKYQVLDGEVYPPSVEQASVLMRYPPGVPPEKQMAVGQEVFGLLPGLMLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIIIEEYVQHLSGYFLQLKFDPELLFRAQFQYRNRIALEFNHLYHWHPLMPDSFQVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQRAGRIGGGRNFDYHVLHVAEDVIKESREMRLQSFNEYRKRFGLKPYTSFQEFTGEKEMAAELEELYGDIDALEFYPGLMLEKCQPNSLFGESMIEMGAPFSLKGLLGNPICSPEYWKPSTFGGDVGFNIVNTASLKKLVCLNTKTCPYVSFRVPDYPGDDGSVFVRPSTEL
Sequence Length
576
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ptgs1 recombinant protein
Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes PTGS1, which regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. PTGS1 is thought to be involved in cell-cell signaling and maintaining tissue homeostasis. Alternative splicing of this gene generates two transcript variants. The expression of these two transcripts is differentially regulated by relevant cytokines and growth factors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
69,032 Da
NCBI Official Full Name
Prostaglandin G/H synthase 1
NCBI Official Synonym Full Names
prostaglandin-endoperoxide synthase 1
NCBI Official Symbol
Ptgs1
NCBI Official Synonym Symbols
Cox1; Cox3; Cox-1; Cox-3; Pghs-1
NCBI Protein Information
prostaglandin G/H synthase 1
UniProt Protein Name
Prostaglandin G/H synthase 1
UniProt Gene Name
Ptgs1
UniProt Synonym Gene Names
Cox-1; Cox1; COX-1; PGH synthase 1; PGHS-1; PHS 1

NCBI Description

This is one of two genes encoding similar enzymes that catalyze the conversion of arachinodate to prostaglandin. The encoded protein regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. Based on its ability to function as both a cyclooxygenase and as a peroxidase, the encoded protein has been identified as a moonlighting protein. [provided by RefSeq, Jan 2014]

Uniprot Description

Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells.

Research Articles on Ptgs1

Similar Products

Product Notes

The Ptgs1 ptgs1 (Catalog #AAA1421294) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-602, full length protein. The amino acid sequence is listed below: TDAGVPSPVN PCCYYPCQNQ GVCVRFGLDH YQCDCTRTGY SGPNCTIPEI WTWLRSSLRP SPSFTHFLLT HGYWIWEFVN ATFIREVLMR LVITVRSNLI PSPPTYNTAH DYISWESFSN VSYYTRILPS VPKDCPTPMG TKGKKQLPDI HLLAQRLLLR REFIPGPQGT NVLFAFFAQH FTHQFFKTSG KMGPGFTKAL GHGVDLGHIY GDSLERQYHL RLFKDGKLKY QVLDGEVYPP SVEQASVLMR YPPGVPPEKQ MAVGQEVFGL LPGLMLFSTI WLREHNRVCD LLKEEHPTWD DEQLFQTTRL ILIGETIKII IEEYVQHLSG YFLQLKFDPE LLFRAQFQYR NRIALEFNHL YHWHPLMPDS FQVGSQEYSY EQFLFNTSML VDYGVEALVD AFSRQRAGRI GGGRNFDYHV LHVAEDVIKE SREMRLQSFN EYRKRFGLKP YTSFQEFTGE KEMAAELEEL YGDIDALEFY PGLMLEKCQP NSLFGESMIE MGAPFSLKGL LGNPICSPEY WKPSTFGGDV GFNIVNTASL KKLVCLNTKT CPYVSFRVPD YPGDDGSVFV RPSTEL. It is sometimes possible for the material contained within the vial of "Prostaglandin G/H synthase 1 (Ptgs1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.