Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

5'-AMP-activated protein kinase subunit beta-1 (Prkab1) Recombinant Protein | Prkab1 recombinant protein

Recombinant Mouse 5'-AMP-activated protein kinase subunit beta-1 (Prkab1)

Gene Names
Prkab1; AU021155; E430008F22; 1300015D22Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5'-AMP-activated protein kinase subunit beta-1 (Prkab1); Recombinant Mouse 5'-AMP-activated protein kinase subunit beta-1 (Prkab1); Prkab1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-270aa, Full Length of Mature Protein
Sequence
GNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Sequence Length
270
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36.1 kDa
NCBI Official Full Name
5'-AMP-activated protein kinase subunit beta-1
NCBI Official Synonym Full Names
protein kinase, AMP-activated, beta 1 non-catalytic subunit
NCBI Official Symbol
Prkab1
NCBI Official Synonym Symbols
AU021155; E430008F22; 1300015D22Rik
NCBI Protein Information
5'-AMP-activated protein kinase subunit beta-1
UniProt Protein Name
5'-AMP-activated protein kinase subunit beta-1
UniProt Gene Name
Prkab1
UniProt Synonym Gene Names
AMPK subunit beta-1; AMPKb

Uniprot Description

Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3) ().

Research Articles on Prkab1

Similar Products

Product Notes

The Prkab1 prkab1 (Catalog #AAA1468823) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-270aa, Full Length of Mature Protein. The amino acid sequence is listed below: GNTSSERAAL ERQAGHKTPR RDSSGGAKDG DRPKILMDSP EDADIFHSEE IKAPEKEEFL AWQHDLEAND KAPAQARPTV FRWTGGGKEV YLSGSFNNWS KLPLTRSQNN FVAILDLPEG EHQYKFFVDG QWTHDPSEPI VTSQLGTVNN IIQVKKTDFE VFDALMVDSQ KCSDVSELSS SPPGPYHQEP YMSKPEERFK APPILPPHLL QVILNKDTGI SCDPALLPEP NHVMLNHLYA LSIKDGVMVL SATHRYKKKY VTTLLYKPI. It is sometimes possible for the material contained within the vial of "5'-AMP-activated protein kinase subunit beta-1 (Prkab1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.