Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human PEN2/PSENEN Polyclonal Antibody | anti-PEN2/PSENEN antibody

PEN2/PSENEN Rabbit pAb

Gene Names
PSENEN; PEN2; PEN-2; MDS033; MSTP064
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
PEN2/PSENEN; Polyclonal Antibody; PEN2/PSENEN Rabbit pAb; PSENEN; MDS033; MSTP064; PEN-2; PEN2; anti-PEN2/PSENEN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
LGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
Applicable Applications for anti-PEN2/PSENEN antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human PEN2/PEN2/PSENEN (NP_758844.1).
Cellular Location
Endoplasmic reticulum membrane, Golgi apparatus, Golgi stack membrane, Multi-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-PEN2/PSENEN antibody
Background: Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,029 Da
NCBI Official Full Name
gamma-secretase subunit PEN-2
NCBI Official Synonym Full Names
presenilin enhancer gamma secretase subunit
NCBI Official Symbol
PSENEN
NCBI Official Synonym Symbols
PEN2; PEN-2; MDS033; MSTP064
NCBI Protein Information
gamma-secretase subunit PEN-2; presenilin enhancer 2 homolog; hematopoietic stem/progenitor cells protein MDS033
UniProt Protein Name
Gamma-secretase subunit PEN-2
UniProt Gene Name
PSENEN
UniProt Synonym Gene Names
PEN2
UniProt Entry Name
PEN2_HUMAN

NCBI Description

Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Uniprot Description

PSENEN: Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (beta- amyloid precursor protein). Probably represents the last step of maturation of gamma-secretase, facilitating endoproteolysis of presenilin and conferring gamma-secretase activity. Component of the gamma-secretase complex, a complex composed of a presenilin homodimer (PSEN1 or PSEN2), nicastrin (NCSTN), APH1 (APH1A or APH1B) and PSENEN/PEN2. Such minimal complex is sufficient for secretase activity, although other components may exist. Widely expressed. Expressed in leukocytes, lung, placenta, small intestine, liver, kidney, spleen thymus, skeletal muscle, heart and brain. Belongs to the PEN-2 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.12

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; endoplasmic reticulum; integral to plasma membrane; plasma membrane

Molecular Function: protein binding

Biological Process: positive regulation of catalytic activity; axon guidance; Notch signaling pathway; amyloid precursor protein catabolic process; membrane protein intracellular domain proteolysis; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; membrane protein ectodomain proteolysis; ephrin receptor signaling pathway; Notch receptor processing; protein processing

Disease: Acne Inversa, Familial, 2

Research Articles on PEN2/PSENEN

Similar Products

Product Notes

The PEN2/PSENEN psenen (Catalog #AAA9142358) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PEN2/PSENEN Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PEN2/PSENEN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PEN2/PSENEN psenen for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGGFAFLPFL WLVNIFWFFR EAFLVPAYTE QSQIKGYVWR SAVGFLFWVI VLTSWITIFQ IYRPRWGALG DYLSFTIPLG TP. It is sometimes possible for the material contained within the vial of "PEN2/PSENEN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.