Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Morphogenetic Protein-7 Polyclonal Antibody | anti-BMP-7 antibody

Polyclonal Rabbit Anti Human Bone Morphogenetic Protein-7

Gene Names
bmp7.2; bmp7
Purity
Greater than 98%.
Purified IgG prepared by affinity chromatography on protein G.
Synonyms
Morphogenetic Protein-7; Polyclonal Antibody; Polyclonal Rabbit Anti Human Bone Morphogenetic Protein-7; BMP-7 Antibody; Bone Morphogenetic Protein-7 Polyclonal Rabbit Anti Human Antibody; Osteogenic Protein 1; BMP-7; anti-BMP-7 antibody
Ordering
For Research Use Only!
Clonality
Polyclonal
Purity/Purification
Greater than 98%.
Purified IgG prepared by affinity chromatography on protein G.
Form/Format
Lyophilized from a sterile filtered (0.2 um) solution containing phosphate buffered saline.
Sequence
FPTI PLSRLFDNAM LRAHRLHQLA FDTYQ EFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLE LLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL KDLEEGIQTLMGRLE DGSPRTGQIFKQ TYSK DTNSHNDDALLKNYGLLYCFRK DM DKVETFLRIVQCRSVEGSCGF
Sequence Length
426
Solubility
Add 100 ?l of distilled water to create a final concentration of 1 mg/ml.
Immunogen
IgG Anti BMP-7 has been developed in rabbit using highly pure (>98%) recombinant human BMP-7 expressed in plants.
Related Product Information for anti-BMP-7 antibody
Introduction: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Product Categories/Family for anti-BMP-7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48,965 Da
NCBI Official Full Name
bone morphogenetic protein 7
NCBI Official Synonym Full Names
bone morphogenetic protein 7, gene 2
NCBI Official Symbol
bmp7.2
NCBI Official Synonym Symbols
bmp7
NCBI Protein Information
bone morphogenetic protein 7; BMP-7; OP-1; osteogenic protein 1; xBMP7
UniProt Protein Name
Bone morphogenetic protein 7
UniProt Gene Name
bmp7
UniProt Synonym Gene Names
BMP-7; xBMP7; OP-1
UniProt Entry Name
BMP7_XENLA

Uniprot Description

Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.

Research Articles on BMP-7

Similar Products

Product Notes

The BMP-7 bmp7 (Catalog #AAA141026) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: FPTI PLSRLFDNAM LRAHRLHQLA FDTYQ  ;EFEEAYIPK EQKYSFLQNP QTSLCFSESI PTPSNREETQ QKSNLE&nbs p;LLRISLLL IQSWLEPVQF LRSVFANSLV YGASDSNVYD LL KDLEEGIQTL MGRLE DGSPRTGQIF KQ TYSK DTNSHNDDAL LKNYGLLYCF RK DM DKVETFLRIV QCRSVEGSCG F. It is sometimes possible for the material contained within the vial of "Morphogenetic Protein-7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.