Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human IL19 Polyclonal Antibody | anti-IL19 antibody

IL19 (ZMDA1, Interleukin-19, IL-19, Melanoma Differentiation-associated Protein-like Protein, NG.1) (MaxLight 750)

Gene Names
IL19; MDA1; NG.1; ZMDA1; IL-10C
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL19; Polyclonal Antibody; IL19 (ZMDA1; Interleukin-19; IL-19; Melanoma Differentiation-associated Protein-like Protein; NG.1) (MaxLight 750); anti-IL19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IL19.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-IL19 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human IL19, aa1-215 (NP_715639.1).
Immunogen Sequence
MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGMKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
Conjugate
MaxLight750
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-IL19 antibody
May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis.
Product Categories/Family for anti-IL19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.9 kDa (predicted detection band MW)
NCBI Official Full Name
interleukin-19 isoform 1
NCBI Official Synonym Full Names
interleukin 19
NCBI Official Symbol
IL19
NCBI Official Synonym Symbols
MDA1; NG.1; ZMDA1; IL-10C
NCBI Protein Information
interleukin-19
UniProt Protein Name
Interleukin-19
Protein Family
UniProt Gene Name
IL19
UniProt Synonym Gene Names
ZMDA1; IL-19
UniProt Entry Name
IL19_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

IL19: May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis. Belongs to the IL-10 family.

Protein type: Secreted, signal peptide; Secreted; Cytokine; Apoptosis

Chromosomal Location of Human Ortholog: 1q32.2

Cellular Component: extracellular space; extracellular region

Molecular Function: cytokine activity

Biological Process: apoptosis; positive regulation of JAK-STAT cascade; immune response; signal transduction; inflammatory response; interleukin-6 biosynthetic process

Research Articles on IL19

Similar Products

Product Notes

The IL19 il19 (Catalog #AAA6382660) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL19 (ZMDA1, Interleukin-19, IL-19, Melanoma Differentiation-associated Protein-like Protein, NG.1) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL19 il19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.