Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ELSPBP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Mouse, Rat ELSPBP1 Polyclonal Antibody | anti-ELSPBP1 antibody

ELSPBP1 Rabbit pAb

Gene Names
ELSPBP1; E12; HE12; EL149; EDDM12
Reactivity
Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
ELSPBP1; Polyclonal Antibody; ELSPBP1 Rabbit pAb; E12; EDDM12; EL149; HE12; anti-ELSPBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
QQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNEGSKENLVWCATSYNYDQDHTWVYC
Applicable Applications for anti-ELSPBP1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 110-223 of human ELSPBP1 (NP_071425.3).
Cellular Location
Secreted
Positive Samples
Mouse testis, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ELSPBP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using ELSPBP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Immunofluorescence (IF)

(Immunofluorescence analysis of rat testis using ELSPBP1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of rat testis using ELSPBP1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF)

(Immunofluorescence analysis of mouse testis using ELSPBP1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of mouse testis using ELSPBP1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-ELSPBP1 antibody
Background: The protein encoded by this gene belongs to the sperm-coating protein family of epididymal origin. This protein and its canine homolog are the first known examples of proteins with four tandemly arranged fibronectin type 2 (Fn2) domains in the Fn2-module protein family.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
223
NCBI Official Full Name
Epididymal sperm-binding protein 1
NCBI Official Synonym Full Names
epididymal sperm binding protein 1
NCBI Official Symbol
ELSPBP1
NCBI Official Synonym Symbols
E12; HE12; EL149; EDDM12
NCBI Protein Information
epididymal sperm-binding protein 1; epididymal protein 12; epididymal secretory protein 12; epididymis luminal secretory protein 149
UniProt Protein Name
Epididymal sperm-binding protein 1
UniProt Gene Name
ELSPBP1
UniProt Synonym Gene Names
E12; hE12
UniProt Entry Name
ESPB1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the sperm-coating protein family of epididymal origin. This protein and its canine homolog are the first known examples of proteins with four tandemly arranged fibronectin type 2 (Fn2) domains in the Fn2-module protein family. [provided by RefSeq, Jul 2008]

Uniprot Description

ELSPBP1: Binds to spermatozoa upon ejaculation and may play a role in sperm capacitation. Has phosphorylcholine-binding activity. Belongs to the seminal plasma protein family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: extracellular region

Biological Process: single fertilization

Research Articles on ELSPBP1

Similar Products

Product Notes

The ELSPBP1 elspbp1 (Catalog #AAA9142124) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELSPBP1 Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELSPBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:200. Researchers should empirically determine the suitability of the ELSPBP1 elspbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QQWKFCETNE YGGNSLRKPC IFPSIYRNNV VSDCMEDESN KLWCPTTENM DKDGKWSFCA DTRISALVPG FPCHFPFNYK NKNYFNCTNE GSKENLVWCA TSYNYDQDHT WVYC. It is sometimes possible for the material contained within the vial of "ELSPBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.