Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CD59 Polyclonal Antibody | anti-CD59 antibody

CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, M

Gene Names
CD59; 1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Purified
Synonyms
CD59; Polyclonal Antibody; CD59 (CD59 Glycoprotein; 1F5 Antigen; 20kD Homologous Restriction Factor; HRF-20; HRF20; MAC-inhibitory Protein; MAC-IP; MEM43 Antigen; Membrane Attack Complex Inhibition Factor; MACIF; Membrane Inhibitor of Reactive Lysis; MIRL; Protectin; MIC11; MIN1; M; anti-CD59 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD59.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-CD59 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length protein corresponding to aa 1-128 from human CD59, (NP_000602.1).
Immunogen Sequence
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CD59 antibody
CD59 is a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. CD59 is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. CD59 also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene.
Product Categories/Family for anti-CD59 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
966
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,177 Da
NCBI Official Full Name
CD59 glycoprotein preproprotein
NCBI Official Synonym Full Names
CD59 molecule, complement regulatory protein
NCBI Official Symbol
CD59
NCBI Official Synonym Symbols
1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20
NCBI Protein Information
CD59 glycoprotein; 1F5 antigen; 20 kDa homologous restriction factor; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344); Ly-6-like protein; MEM43 antigen; T cell-activating protein; human leukocyte antigen
UniProt Protein Name
CD59 glycoprotein
Protein Family
UniProt Gene Name
CD59
UniProt Synonym Gene Names
MIC11; MIN1; MIN2; MIN3; MSK21; HRF-20; HRF20; MAC-IP; MACIF; MIRL
UniProt Entry Name
CD59_HUMAN

NCBI Description

This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CD59: Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase. Defects in CD59 are the cause of CD59 deficiency (CD59D).

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: anchored to external side of plasma membrane; compact myelin; extracellular space; cell surface; focal adhesion; membrane; extracellular region; plasma membrane; sarcolemma; vesicle

Molecular Function: complement binding; protein binding

Biological Process: cell activation; cell surface receptor linked signal transduction; regulation of complement activation; innate immune response; negative regulation of activation of membrane attack complex; positive regulation of T cell proliferation; blood coagulation; negative regulation of apoptosis

Disease: Hemolytic Anemia, Cd59-mediated, With Or Without Immune-mediated Polyneuropathy

Research Articles on CD59

Similar Products

Product Notes

The CD59 cd59 (Catalog #AAA6373187) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, M reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD59 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD59 cd59 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD59, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.