Pogo transposable element with ZNF domain (POGZ) Recombinant Protein | POGZ recombinant protein
Recombinant Human Pogo transposable element with ZNF domain (POGZ) , partial
Gene Names
POGZ; MRD37; WHSUS; ZNF635; ZNF280E; ZNF635m
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pogo transposable element with ZNF domain (POGZ); Recombinant Human Pogo transposable element with ZNF domain (POGZ); partial; POGZ recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-363; Provide the full length of Isoform 4 (identifier: Q7Z3K3-4)
Sequence
MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVAGHLSTSTTVSSSGAQNSDSTKKTLVTLIANNNAGNPLVQQGGQPLILTQNPAPGLGTMVTQPVLRPVQVMQNANHVTSSPVASQPIFITTQGFPVRNVRPVQNAMNQVGIVLNVQQGQTVRPITLVPAPGTQFVKPTVGVPQVFSQMTPVRPGSTMPVRPTTNTFTTVIPATLTIRSTVPQSQSQQTKSTPSTSTTPTATQPTSLGQLAVQSPGQSNQTTNPKLAPSFPSPPAVSIASFVTVKRPGVTGENSNEVAKLVNTLNTIPSLGQSPGPVVVSNNSSAHGSQRTSGPESSMKGTIT
Sequence Length
363
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for POGZ recombinant protein
This protein appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid system. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
149,278 Da
NCBI Official Full Name
pogo transposable element with ZNF domain isoform 4
NCBI Official Synonym Full Names
pogo transposable element derived with ZNF domain
NCBI Official Symbol
POGZ
NCBI Official Synonym Symbols
MRD37; WHSUS; ZNF635; ZNF280E; ZNF635m
NCBI Protein Information
pogo transposable element with ZNF domain
UniProt Protein Name
Pogo transposable element with ZNF domain
Protein Family
UniProt Gene Name
POGZ
UniProt Synonym Gene Names
KIAA0461; SUHW5; ZNF280E; ZNF635
NCBI Description
The protein encoded by this gene appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid system. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Aug 2010]
Uniprot Description
Plays a role in mitotic cell cycle progression and is involved in kinetochore assembly and mitotic sister chromatid cohesion. Probably through its association with CBX5 plays a role in mitotic chromosome segregation by regulating aurora kinase B/AURKB activation and AURKB and CBX5 dissociation from chromosome arms.
Research Articles on POGZ
Similar Products
Product Notes
The POGZ pogz (Catalog #AAA1473756) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-363; Provide the full length of Isoform 4 (identifier: Q7Z3K3-4). The amino acid sequence is listed below: MADTDLFMEC EEEELEPWQK ISDVIEDSVV EDYNSVDKTT TVSVSQQPVS APVPIAAHAS VAGHLSTSTT VSSSGAQNSD STKKTLVTLI ANNNAGNPLV QQGGQPLILT QNPAPGLGTM VTQPVLRPVQ VMQNANHVTS SPVASQPIFI TTQGFPVRNV RPVQNAMNQV GIVLNVQQGQ TVRPITLVPA PGTQFVKPTV GVPQVFSQMT PVRPGSTMPV RPTTNTFTTV IPATLTIRST VPQSQSQQTK STPSTSTTPT ATQPTSLGQL AVQSPGQSNQ TTNPKLAPSF PSPPAVSIAS FVTVKRPGVT GENSNEVAKL VNTLNTIPSL GQSPGPVVVS NNSSAHGSQR TSGPESSMKG TIT . It is sometimes possible for the material contained within the vial of "Pogo transposable element with ZNF domain (POGZ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
