Lipid phosphate phosphatase-related protein type 4 (Lppr4) Recombinant Protein | Lppr4 recombinant protein
Recombinant Mouse Lipid phosphate phosphatase-related protein type 4 (Lppr4)
Gene Names
Plppr4; Lppr4; PRG-1; mKIAA0455; A330086D10; D3Bwg0562e
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipid phosphate phosphatase-related protein type 4 (Lppr4); Recombinant Mouse Lipid phosphate phosphatase-related protein type 4 (Lppr4); Lppr4 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-766aa; full length protein
Sequence
MQRAGSSGARGECDISGAGRLRLEQAARLGGRTVHTSPGGGLGARQAAGMSAKERPKGKV IKDSVTLLPCFYFVELPILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEA IPFLMLLSLAFAGPAITIMVGEGILYCCLSKRRNGAGLEPNINAGGCNFNSFLRRAVRFV GVHVFGLCSTALITDIIQLSTGYQAPYFLTVCKPNYTSLNVSCKENSYIVEDICSGSDLT VINSGRKSFPSQHATLAAFAAVYVSMYFNSTLTDSSKLLKPLLVFTFIICGIICGLTRIT QYKNHPVDVYCGFLIGGGIALYLGLYAVGNFLPSEDSMLQHRDALRSLTDLNQDPSRVLS AKNGSSGDGIAHTEGILNRNHRDASSLTNLKRANADVEIITPRSPMGKESMVTFSNTLPR ANTPSVEDPVRRNASIHASMDSARSKQLLTQWKSKNESRKMSLQVMDTEPEGQSPPRSIE MRSSSEPSRVGVNGDHHVPGNQYLKIQPGTVPGCNNSMPGGPRVSIQSRPGSSQLVHIPE ETQENISTSPKSSSARAKWLKAAEKTVACNRSNNQPRIMQVIAMSKQQGVLQSSPKNAEG STVTCTGSIRYKTLTDHEPSGIVRVEAHPENNRPIIQIPSSTEGEGSGSWKWKAPEKSSL RQTYELNDLNRDSESCESLKDSFGSGDRKRSNIDSNEHHHHGITTIRVTPVEGSEIGSET LSVSSSRDSTLRRKGNIILIPERSNSPENTRNIFYKGTSPTRAYKD
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Lppr4 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
83,290 Da
NCBI Official Full Name
phospholipid phosphatase-related protein type 4
NCBI Official Synonym Full Names
phospholipid phosphatase related 4
NCBI Official Symbol
Plppr4
NCBI Official Synonym Symbols
Lppr4; PRG-1; mKIAA0455; A330086D10; D3Bwg0562e
NCBI Protein Information
phospholipid phosphatase-related protein type 4
UniProt Protein Name
Phospholipid phosphatase-related protein type 4
UniProt Gene Name
Plppr4
UniProt Synonym Gene Names
PRG-1
UniProt Entry Name
PLPR4_MOUSE
Uniprot Description
LPPR4: Hydrolyzes lysophosphatidic acid (LPA). Facilitates axonal outgrowth during development and regenerative sprouting. In the outgrowing axons acts as an ecto-enzyme and attenuates phospholipid-induced axon collapse in neurons and facilitates outgrowth in the hippocampus. Belongs to the PA-phosphatase related phosphoesterase family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Cell development/differentiation; Membrane protein, multi-pass; EC 3.1.3.4; Phosphatase, lipid
Cellular Component: external side of plasma membrane; integral to membrane; integral to plasma membrane; membrane
Molecular Function: hydrolase activity; lipid phosphatase activity; phosphatidate phosphatase activity; protein binding
Biological Process: axonogenesis; inner ear development; phospholipid dephosphorylation; phospholipid metabolic process; signal transduction
Research Articles on Lppr4
Similar Products
Product Notes
The Lppr4 plppr4 (Catalog #AAA7019064) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-766aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Lppr4 plppr4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQRAGSSGAR GECDISGAGR LRLEQAARLG GRTVHTSPGG GLGARQAAGM SAKERPKGKV IKDSVTLLPC FYFVELPILA SSVVSLYFLE LTDVFKPVHS GFSCYDRSLS MPYIEPTQEA IPFLMLLSLA FAGPAITIMV GEGILYCCLS KRRNGAGLEP NINAGGCNFN SFLRRAVRFV GVHVFGLCST ALITDIIQLS TGYQAPYFLT VCKPNYTSLN VSCKENSYIV EDICSGSDLT VINSGRKSFP SQHATLAAFA AVYVSMYFNS TLTDSSKLLK PLLVFTFIIC GIICGLTRIT QYKNHPVDVY CGFLIGGGIA LYLGLYAVGN FLPSEDSMLQ HRDALRSLTD LNQDPSRVLS AKNGSSGDGI AHTEGILNRN HRDASSLTNL KRANADVEII TPRSPMGKES MVTFSNTLPR ANTPSVEDPV RRNASIHASM DSARSKQLLT QWKSKNESRK MSLQVMDTEP EGQSPPRSIE MRSSSEPSRV GVNGDHHVPG NQYLKIQPGT VPGCNNSMPG GPRVSIQSRP GSSQLVHIPE ETQENISTSP KSSSARAKWL KAAEKTVACN RSNNQPRIMQ VIAMSKQQGV LQSSPKNAEG STVTCTGSIR YKTLTDHEPS GIVRVEAHPE NNRPIIQIPS STEGEGSGSW KWKAPEKSSL RQTYELNDLN RDSESCESLK DSFGSGDRKR SNIDSNEHHH HGITTIRVTP VEGSEIGSET LSVSSSRDST LRRKGNIILI PERSNSPENT RNIFYKGTSP TRAYKD. It is sometimes possible for the material contained within the vial of "Lipid phosphate phosphatase-related protein type 4 (Lppr4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
