Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lipid phosphate phosphohydrolase 1 (PPAP2A) Recombinant Protein | PPAP2A recombinant protein

Recombinant Human Lipid phosphate phosphohydrolase 1 (PPAP2A)

Gene Names
PLPP1; LPP1; PAP2; LLP1a; PAP-2a; PPAP2A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipid phosphate phosphohydrolase 1 (PPAP2A); Recombinant Human Lipid phosphate phosphohydrolase 1 (PPAP2A); PPAP2A recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-284aa Full Length
Sequence
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for PPAP2A recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,150 Da
NCBI Official Full Name
phospholipid phosphatase 1 isoform 1
NCBI Official Synonym Full Names
phospholipid phosphatase 1
NCBI Official Symbol
PLPP1
NCBI Official Synonym Symbols
LPP1; PAP2; LLP1a; PAP-2a; PPAP2A
NCBI Protein Information
phospholipid phosphatase 1
UniProt Protein Name
Phospholipid phosphatase 1
UniProt Gene Name
PLPP1
UniProt Synonym Gene Names
PAP-2a; PAP2a
UniProt Entry Name
PLPP1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Uniprot Description

PPAP2A: Broad-specificity phosphohydrolase that dephosphorylates exogenous bioactive glycerolipids and sphingolipids. Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). Pivotal regulator of lysophosphatidic acid (LPA) signaling in the cardiovascular system. Major enzyme responsible of dephosphorylating LPA in platelets, which terminates signaling actions of LPA. May control circulating, and possibly also regulate localized, LPA levels resulting from platelet activation. It has little activity towards ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P). The relative catalytic efficiency is LPA > PA > S-1-P > C-1-P. It's down-regulation may contribute to the development of colon adenocarcinoma. Belongs to the PA-phosphatase related phosphoesterase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Lipid Metabolism - ether lipid; EC 3.1.3.4; Lipid Metabolism - glycerolipid; Motility/polarity/chemotaxis; Lipid Metabolism - sphingolipid; Membrane protein, integral; Lipid Metabolism - glycerophospholipid; Phosphatase (non-protein)

Chromosomal Location of Human Ortholog: 5q11

Cellular Component: integral to plasma membrane; membrane; plasma membrane

Molecular Function: lipid phosphatase activity; phosphatidate phosphatase activity; sphingosine-1-phosphate phosphatase activity

Biological Process: androgen receptor signaling pathway; germ cell migration; lipid metabolic process; negative regulation of cell proliferation; phospholipid dephosphorylation; phospholipid metabolic process; protein amino acid dephosphorylation; protein kinase C activation; regulation of lipid metabolic process; sphingolipid biosynthetic process; steroid hormone receptor signaling pathway

Research Articles on PPAP2A

Similar Products

Product Notes

The PPAP2A plpp1 (Catalog #AAA7026871) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-284aa Full Length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the PPAP2A plpp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFDKTRLPYV ALDVLCVLLA GLPFAILTSR HTPFQRGVFC NDESIKYPYK EDTIPYALLG GIIIPFSIIV IILGETLSVY CNLLHSNSFI RNNYIATIYK AIGTFLFGAA ASQSLTDIAK YSIGRLRPHF LDVCDPDWSK INCSDGYIEY YICRGNAERV KEGRLSFYSG HSSFSMYCML FVALYLQARM KGDWARLLRP TLQFGLVAVS IYVGLSRVSD YKHHWSDVLT GLIQGALVAI LVAVYVSDFF KERTSFKERK EEDSHTTLHE TPTTGNHYPS NHQP . It is sometimes possible for the material contained within the vial of "Lipid phosphate phosphohydrolase 1 (PPAP2A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.