Pituitary homeobox 2 (PITX2) Recombinant Protein | PITX2 recombinant protein
Recombinant Chicken Pituitary homeobox 2 (PITX2)
Gene Names
PITX2; Ptx2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pituitary homeobox 2 (PITX2); Recombinant Chicken Pituitary homeobox 2 (PITX2); PITX2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-333, Full length protein
Sequence
MSCMKDPLSLERLGAGNNKLCSSSPSSSSSSSSCHHQQPALAMATALAPGQARSSLEAAKHRLEVHTISDTSSPEAAEKEKSQQGKSEDAGPEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSGLNSLNNLNNLSNPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYPVDRPV
Sequence Length
333
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PITX2 recombinant protein
This gene encodes a member of the RIEG
PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.
PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,330 Da
NCBI Official Full Name
pituitary homeobox 2
NCBI Official Synonym Full Names
paired like homeodomain 2
NCBI Official Symbol
PITX2
NCBI Official Synonym Symbols
Ptx2
NCBI Protein Information
pituitary homeobox 2
UniProt Protein Name
Pituitary homeobox 2
Protein Family
UniProt Gene Name
PITX2
UniProt Synonym Gene Names
PTX2; cPITX2
Uniprot Description
May play an important role in development and maintenance of anterior structures. May play a role in determining left-right asymmetry and in vasculogenesis during avian embryogenesis.
Research Articles on PITX2
Similar Products
Product Notes
The PITX2 pitx2 (Catalog #AAA1139120) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-333, Full length protein. The amino acid sequence is listed below: MSCMKDPLSL ERLGAGNNKL CSSSPSSSSS SSSCHHQQPA LAMATALAPG QARSSLEAAK HRLEVHTISD TSSPEAAEKE KSQQGKSEDA GPEDPSKKKR QRRQRTHFTS QQLQELEATF QRNRYPDMST REEIAVWTNL TEARVRVWFK NRRAKWRKRE RNQQAELCKN GFGPQFNGLM QPYDDMYPGY SYNNWAAKGL TSASLSTKSF PFFNSMNVNP LSSQSMFSPP NSISSMSMSS SMVPSAVTGV PGSGLNSLNN LNNLSNPSLN SAVPTPACPY APPTPPYVYR DTCNSSLASL RLKAKQHSSF GYASVQNPAS NLSACQYPVD RPV. It is sometimes possible for the material contained within the vial of "Pituitary homeobox 2 (PITX2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
