Mortality factor 4-like protein 2 (MORF4L2) Recombinant Protein | MORF4L2 recombinant protein

Recombinant Human Mortality factor 4-like protein 2 (MORF4L2)

Cat. Num. AAA1305431

• Gene Names: MORF4L2; MRGX; MORFL2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mortality factor 4-like protein 2 (MORF4L2); Recombinant Human Mortality factor 4-like protein 2 (MORF4L2); MORF4L2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-288, Full length protein
• Sequence: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL
• Sequence Length: 288

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 215490021
• NCBI GeneID: 9643
• NCBI Accession #: NP_001135890.1
• NCBI GenBank Nucleotide #: NM_001142418.1
• UniProt Accession #: Q15014; Q567V0; Q8J026; B3KP92; D3DXA5
• Molecular Weight: 32,308 Da
• NCBI Official Full Name: mortality factor 4-like protein 2
• NCBI Official Synonym Full Names: mortality factor 4 like 2
• NCBI Official Symbol: MORF4L2
• NCBI Official Synonym Symbols: MRGX; MORFL2
• NCBI Protein Information: mortality factor 4-like protein 2
• UniProt Protein Name: Mortality factor 4-like protein 2
• Protein Family: Mortality factor 4-like protein
• UniProt Gene Name: MORF4L2
• UniProt Synonym Gene Names: KIAA0026; MRGX

Uniprot Description

Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the MSIN3A complex which acts to repress transcription by deacetylation of nucleosomal histones.