Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse TXK Monoclonal Antibody | anti-TXK antibody

TXK (TXK Tyrosine Kinase, BTKL, MGC22473, PSCTK5, PTK4, RLK, TKL) (APC)

Gene Names
TXK; RLK; TKL; BTKL; PTK4; PSCTK5
Applications
ELISA
Purity
Purified
Synonyms
TXK; Monoclonal Antibody; TXK (TXK Tyrosine Kinase; BTKL; MGC22473; PSCTK5; PTK4; RLK; TKL) (APC); TXK Tyrosine Kinase; TKL; anti-TXK antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1H5
Specificity
Recognizes TXK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
527
Applicable Applications for anti-TXK antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TXK (NP_003319, 131aa-230aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRHLGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWY
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TXK antibody
Mouse monoclonal antibody raised against a partial recombinant TXK.
Product Categories/Family for anti-TXK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tyrosine-protein kinase TXK
NCBI Official Synonym Full Names
TXK tyrosine kinase
NCBI Official Symbol
TXK
NCBI Official Synonym Symbols
RLK; TKL; BTKL; PTK4; PSCTK5
NCBI Protein Information
tyrosine-protein kinase TXK
UniProt Protein Name
Tyrosine-protein kinase TXK
Protein Family
UniProt Gene Name
TXK
UniProt Synonym Gene Names
PTK4; RLK
UniProt Entry Name
TXK_HUMAN

Uniprot Description

TXK: Non-receptor tyrosine kinase that plays a redundant role with ITK in regulation of the adaptive immune response. Regulates the development, function and differentiation of conventional T- cells and nonconventional NKT-cells. When antigen presenting cells (APC) activate T-cell receptor (TCR), a series of phosphorylation lead to the recruitment of TXK to the cell membrane, where it is phosphorylated at Tyr-420. Phosphorylation leads to TXK full activation. Contributes also to signaling from many receptors and participates in multiple downstream pathways, including regulation of the actin cytoskekleton. Like ITK, can phosphorylate PLCG1, leading to its localization in lipid rafts and activation, followed by subsequent cleavage of its substrates. In turn, the endoplasmic reticulum releases calcium in the cytoplasm and the nuclear activator of activated T-cells (NFAT) translocates into the nucleus to perform its transcriptional duty. With PARP1 and EEF1A1, TXK forms a complex that acts as a T-helper 1 (Th1) cell- specific transcription factor and binds the promoter of IFNG to directly regulate its transcription, and is thus involved importantly in Th1 cytokine production. Phosphorylates both PARP1 and EEF1A1. Phosphorylates also key sites in LCP2 leading to the up-regulation of Th1 preferred cytokine IL-2. Phosphorylates 'Tyr- 201' of CTLA4 which leads to the association of PI-3 kinase with the CTLA4 receptor. Belongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.

Protein type: Protein kinase, TK; Protein kinase, tyrosine (non-receptor); EC 2.7.10.2; Kinase, protein; TK group; Tec family

Chromosomal Location of Human Ortholog: 4p12

Cellular Component: extrinsic to internal side of plasma membrane; cytoplasm; nucleus

Molecular Function: protein binding; non-membrane spanning protein tyrosine kinase activity; ATP binding; receptor binding

Biological Process: adaptive immune response; transcription, DNA-dependent; protein amino acid autophosphorylation; cytokine production; T cell receptor signaling pathway; protein amino acid phosphorylation; regulation of cell proliferation; regulation of transcription from RNA polymerase II promoter; interleukin-4 production; B cell receptor signaling pathway; positive regulation of interferon-gamma production; phospholipase C activation; interferon-gamma production; positive regulation of transcription from RNA polymerase II promoter; NK T cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; T cell differentiation

Research Articles on TXK

Similar Products

Product Notes

The TXK txk (Catalog #AAA6166707) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TXK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TXK txk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TXK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.