Mouse anti-Human TAGLN Monoclonal Antibody | anti-TAGLN antibody
TAGLN (Transgelin, 22kD Actin-binding Protein, Protein WS3-10, Smooth Muscle Protein 22-alpha, SM22-alpha, SM22, WS3-10, DKFZp686P11128) (MaxLight 405)
Gene Names
TAGLN; SM22; SMCC; TAGLN1; WS3-10
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAGLN; Monoclonal Antibody; TAGLN (Transgelin; 22kD Actin-binding Protein; Protein WS3-10; Smooth Muscle Protein 22-alpha; SM22-alpha; SM22; WS3-10; DKFZp686P11128) (MaxLight 405); anti-TAGLN antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E2
Specificity
Recognizes human TAGLN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-TAGLN antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-202 from human TAGLN (AAH04927) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TAGLN antibody
TAGLN (Transgelin), otherwise known as SM22-alpha, a shape change sensitive, actin cross-linking/gelling protein, and member of the calponin family, which plays a role in calcium interactions and contractile properties of the cell. TAGLN is ubiquitously expressed by vascular and visceral smooth muscle, and an early marker of smooth muscle differentiation, and also overexpressed by senescent human fibroblasts. Studies have identified TAGLN as a novel tumor suppressor protein, which has a markedly reduced expression in colorectal cancer samples, and may serve as an important biomarker of malignancy.
Product Categories/Family for anti-TAGLN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI GenBank Nucleotide #
NCBI Official Full Name
transgelin
NCBI Official Synonym Full Names
transgelin
NCBI Official Symbol
TAGLN
NCBI Official Synonym Symbols
SM22; SMCC; TAGLN1; WS3-10
NCBI Protein Information
transgelin; 22 kDa actin-binding protein; SM22-alpha; smooth muscle protein 22-alpha; transgelin variant 2
UniProt Protein Name
Transgelin
Protein Family
UniProt Gene Name
TAGLN
UniProt Synonym Gene Names
SM22; WS3-10; SM22-alpha
UniProt Entry Name
TAGL_HUMAN
NCBI Description
The protein encoded by this gene is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
TAGLN: Actin cross-linking/gelling protein. Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence. Belongs to the calponin family.
Protein type: Nuclear receptor co-regulator; Motility/polarity/chemotaxis; Actin-binding
Chromosomal Location of Human Ortholog: 11q23.2
Cellular Component: cytoplasm
Molecular Function: actin filament binding; protein binding
Biological Process: muscle development; epithelial cell differentiation
Research Articles on TAGLN
Similar Products
Product Notes
The TAGLN tagln (Catalog #AAA6192977) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAGLN (Transgelin, 22kD Actin-binding Protein, Protein WS3-10, Smooth Muscle Protein 22-alpha, SM22-alpha, SM22, WS3-10, DKFZp686P11128) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAGLN can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAGLN tagln for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAGLN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
