Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse SUGT1 Monoclonal Antibody | anti-SUGT1 antibody

SUGT1 (SGT1, Suppressor of G2 allele of SKP1 (S. cerevisiae), SGT1) (MaxLight 405)

Gene Names
SUGT1; SGT1
Applications
Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
SUGT1; Monoclonal Antibody; SUGT1 (SGT1; Suppressor of G2 allele of SKP1 (S. cerevisiae); SGT1) (MaxLight 405); SGT1; anti-SUGT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1A10
Specificity
Recognizes SUGT1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-SUGT1 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SUGT1 (NP_006695, 151aa-260aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVG
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SUGT1 antibody
This gene is homologous to the yeast gene SGT1, which encodes a protein involved in kinetochore function and required for the G1/S and G2/M transitions. Complementation studies suggest that the human protein has similar functions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-SUGT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,805 Da
NCBI Official Full Name
suppressor of G2 allele of SKP1 homolog isoform SGT1A
NCBI Official Synonym Full Names
SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
NCBI Official Symbol
SUGT1
NCBI Official Synonym Symbols
SGT1
NCBI Protein Information
suppressor of G2 allele of SKP1 homolog; SGT1B protein; putative 40-6-3 protein; suppressor of G2 allele of SKP1, S. cerevisiae, homolog of
UniProt Protein Name
Suppressor of G2 allele of SKP1 homolog
UniProt Gene Name
SUGT1
UniProt Entry Name
SUGT1_HUMAN

Uniprot Description

SUGT1: a protein involved in kinetochore function and required for the G1/S and G2/M transitions. A subunit of both core kinetochore and SCF (Skp1-Cul1-F-box) ubiquitin ligase complexes. Two alternatively spliced isoforms have been reported.

Protein type: Ubiquitin conjugating system; Cell cycle regulation

Chromosomal Location of Human Ortholog: 13q14.3

Cellular Component: kinetochore; cytoplasm; cytosol; nucleus; ubiquitin ligase complex

Molecular Function: protein binding

Biological Process: mitosis; innate immune response

Similar Products

Product Notes

The SUGT1 sugt1 (Catalog #AAA6198127) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SUGT1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SUGT1 sugt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUGT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.