Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SNAPC4 Monoclonal Antibody | anti-SNAPC4 antibody

SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (MaxLight 490)

Gene Names
SNAPC4; SNAP190; PTFalpha
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
SNAPC4; Monoclonal Antibody; SNAPC4 (Small Nuclear RNA Activating Complex; Polypeptide 4; 190kD; OTTHUMP00000022583; FLJ13451; PTFalpha; SNAP190) (MaxLight 490); anti-SNAPC4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H4
Specificity
Recognizes human SNAPC4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
1469
Applicable Applications for anti-SNAPC4 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa53-162 from human SNAPC4 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSK GTKVKDGKSLPPSTYMGHFMKPYFKDKVTGVGPPAN
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SNAPC4 antibody
Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.
Product Categories/Family for anti-SNAPC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
snRNA-activating protein complex subunit 4
NCBI Official Synonym Full Names
small nuclear RNA activating complex polypeptide 4
NCBI Official Symbol
SNAPC4
NCBI Official Synonym Symbols
SNAP190; PTFalpha
NCBI Protein Information
snRNA-activating protein complex subunit 4
UniProt Protein Name
snRNA-activating protein complex subunit 4
UniProt Gene Name
SNAPC4
UniProt Synonym Gene Names
SNAP190; SNAPc subunit 4; PSE-binding factor subunit alpha; PTF subunit alpha
UniProt Entry Name
SNPC4_HUMAN

NCBI Description

This gene encodes the largest subunit of the small nuclear RNA-activating protein (SNAP) complex. The encoded protein contains a Myb DNA-binding domain, and is essential for RNA polymerase II and III polymerase transcription from small nuclear RNA promoters. A mutation in this gene is associated with ankylosing spondylitis. [provided by RefSeq, Jul 2016]

Uniprot Description

SNAP190: Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: nucleoplasm; snRNA-activating protein complex; nucleus

Molecular Function: DNA binding; chromatin binding; transcription factor activity

Biological Process: transcription from RNA polymerase III promoter; transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; snRNA transcription; snRNA transcription from RNA polymerase II promoter; gene expression; snRNA transcription from RNA polymerase III promoter

Research Articles on SNAPC4

Similar Products

Product Notes

The SNAPC4 snapc4 (Catalog #AAA6204958) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNAPC4 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SNAPC4 snapc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SNAPC4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.