Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SFRS6 Monoclonal Antibody | anti-SFRS6 antibody

SFRS6 (Serine/Arginine-rich Splicing Factor 6, Pre-mRNA-splicing Factor SRP55, Splicing Factor, Arginine/Serine-rich 6, SFRS6, SRP55, FLJ08061, MGC5045) (MaxLight 650)

Gene Names
SRSF6; B52; SFRS6; SRP55; HEL-S-91
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SFRS6; Monoclonal Antibody; SFRS6 (Serine/Arginine-rich Splicing Factor 6; Pre-mRNA-splicing Factor SRP55; Splicing Factor; Arginine/Serine-rich 6; SRP55; FLJ08061; MGC5045) (MaxLight 650); anti-SFRS6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5G6
Specificity
Recognizes human SFRS6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-SFRS6 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-76 from human SFRS6 (NP_006266) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR*
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SFRS6 antibody
Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10.
Product Categories/Family for anti-SFRS6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
serine/arginine-rich splicing factor 6
NCBI Official Synonym Full Names
serine and arginine rich splicing factor 6
NCBI Official Symbol
SRSF6
NCBI Official Synonym Symbols
B52; SFRS6; SRP55; HEL-S-91
NCBI Protein Information
serine/arginine-rich splicing factor 6
UniProt Protein Name
Serine/arginine-rich splicing factor 6
UniProt Gene Name
SRSF6
UniProt Synonym Gene Names
SFRS6; SRP55
UniProt Entry Name
SRSF6_HUMAN

NCBI Description

The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. Alternative splicing results in multiple transcript variants. In addition, two pseudogenes, one on chromosome 17 and the other on the X chromosome, have been found for this gene.[provided by RefSeq, Sep 2010]

Uniprot Description

SFRS6: Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10. Belongs to the splicing factor SR family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Spliceosome; RNA-binding; RNA splicing

Chromosomal Location of Human Ortholog: 20q12-q13.1

Cellular Component: nucleoplasm; nuclear speck

Molecular Function: RNA binding; nucleotide binding

Biological Process: alternative nuclear mRNA splicing, via spliceosome; transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; mRNA splice site selection; mRNA export from nucleus; negative regulation of nuclear mRNA splicing, via spliceosome; RNA splicing; negative regulation of keratinocyte differentiation; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription; regulation of alternative nuclear mRNA splicing, via spliceosome

Research Articles on SFRS6

Similar Products

Product Notes

The SFRS6 srsf6 (Catalog #AAA6224599) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SFRS6 (Serine/Arginine-rich Splicing Factor 6, Pre-mRNA-splicing Factor SRP55, Splicing Factor, Arginine/Serine-rich 6, SFRS6, SRP55, FLJ08061, MGC5045) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SFRS6 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SFRS6 srsf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SFRS6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.