Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PROS1 Monoclonal Antibody | anti-PROS1 antibody

PROS1 (Vitamin K-dependent Protein S, PROS) (MaxLight 550)

Gene Names
PROS1; PSA; PROS; PS21; PS22; PS23; PS24; PS25; THPH5; THPH6
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PROS1; Monoclonal Antibody; PROS1 (Vitamin K-dependent Protein S; PROS) (MaxLight 550); anti-PROS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D7
Specificity
Recognizes human PROS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-PROS1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa419-517, from human PROS1 (NP_000304) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRP
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PROS1 antibody
Protein S is a vitamin K-dependent plasma protein that functions as a cofactor for the anticoagulant protease, activated protein C (APC) to inhibit blood coagulation. It is found in plasma in both a free, functionally active form and also in an inactive form complexed with C4b-binding protein. Mutations in Protein S result in autosomal dominant hereditary thrombophilia.
Product Categories/Family for anti-PROS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,123 Da
NCBI Official Full Name
vitamin K-dependent protein S preproprotein
NCBI Official Synonym Full Names
protein S (alpha)
NCBI Official Symbol
PROS1
NCBI Official Synonym Symbols
PSA; PROS; PS21; PS22; PS23; PS24; PS25; THPH5; THPH6
NCBI Protein Information
vitamin K-dependent protein S; protein Sa; vitamin K-dependent plasma protein S
UniProt Protein Name
Vitamin K-dependent protein S
Protein Family
UniProt Gene Name
PROS1
UniProt Synonym Gene Names
PROS
UniProt Entry Name
PROS_HUMAN

Uniprot Description

PROS1: Anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis. Defects in PROS1 are the cause of thrombophilia due to protein S deficiency, autosomal dominant (THPH5). A hemostatic disorder characterized by impaired regulation of blood coagulation and a tendency to recurrent venous thrombosis. However, many adults with heterozygous disease may be asymptomatic. Based on the plasma levels of total and free PROS1 antigen as well as the serine protease-activated protein C cofactor activity, three types of PROS1D have been described: type I, characterized by reduced total and free PROS1 antigen levels together with reduced anticoagulant activity; type III, in which only free PROS1 antigen and PROS1 activity levels are reduced; and the rare type II which is characterized by normal concentrations of both total and free PROS1 antigen, but low cofactor activity. Defects in PROS1 are the cause of thrombophilia due to protein S deficiency, autosomal recessive (THPH6). A very rare and severe hematologic disorder resulting in thrombosis and secondary hemorrhage usually beginning in early infancy. Some affected individuals develop neonatal purpura fulminans, multifocal thrombosis, or intracranial hemorrhage.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3q11.2

Cellular Component: Golgi membrane; extracellular space; endoplasmic reticulum membrane; Golgi lumen; plasma membrane; extracellular region

Molecular Function: endopeptidase inhibitor activity; calcium ion binding

Biological Process: platelet activation; fibrinolysis; platelet degranulation; cellular protein metabolic process; regulation of complement activation; innate immune response; proteolysis; blood coagulation; post-translational protein modification; leukocyte migration; peptidyl-glutamic acid carboxylation

Disease: Thrombophilia Due To Protein S Deficiency, Autosomal Recessive; Thrombophilia Due To Protein S Deficiency, Autosomal Dominant

Similar Products

Product Notes

The PROS1 pros1 (Catalog #AAA6213368) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PROS1 (Vitamin K-dependent Protein S, PROS) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PROS1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PROS1 pros1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PROS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.