Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human OMD Monoclonal Antibody | anti-OMD antibody

OMD (Osteomodulin, Keratan Sulfate Proteoglycan Osteomodulin, KSPG Osteomodulin, Osteoadherin, OSAD, SLRR2C, UNQ190/PRO216) (PE)

Gene Names
OMD; OSAD; SLRR2C
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
OMD; Monoclonal Antibody; OMD (Osteomodulin; Keratan Sulfate Proteoglycan Osteomodulin; KSPG Osteomodulin; Osteoadherin; OSAD; SLRR2C; UNQ190/PRO216) (PE); anti-OMD antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1E10
Specificity
Recognizes human OMD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-OMD antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa274-384 from human OMD (NP_005005) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-OMD antibody
OMD may be implicated in biomineralization processes. This protein has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.
Product Categories/Family for anti-OMD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,492 Da
NCBI Official Full Name
osteomodulin
NCBI Official Synonym Full Names
osteomodulin
NCBI Official Symbol
OMD
NCBI Official Synonym Symbols
OSAD; SLRR2C
NCBI Protein Information
osteomodulin; KSPG osteomodulin; keratan sulfate proteoglycan osteomodulin; osteoadherin proteoglycan
UniProt Protein Name
Osteomodulin
Protein Family
UniProt Gene Name
OMD
UniProt Synonym Gene Names
SLRR2C; KSPG osteomodulin; OSAD
UniProt Entry Name
OMD_HUMAN

Similar Products

Product Notes

The OMD omd (Catalog #AAA6159221) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The OMD (Osteomodulin, Keratan Sulfate Proteoglycan Osteomodulin, KSPG Osteomodulin, Osteoadherin, OSAD, SLRR2C, UNQ190/PRO216) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OMD can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OMD omd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OMD, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.