Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human NELL2 Monoclonal Antibody | anti-NELL2 antibody

NELL2 (Protein Kinase C-binding Protein NELL2, MEL91 Protein, NEL-like Protein 2, Mel91) (MaxLight 405)

Gene Names
NELL2; NRP2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NELL2; Monoclonal Antibody; NELL2 (Protein Kinase C-binding Protein NELL2; MEL91 Protein; NEL-like Protein 2; Mel91) (MaxLight 405); anti-NELL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F6
Specificity
Recognizes human NELL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-NELL2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa301-400 from human NELL2 (NP_006150) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NELL2 antibody
Protein kinase C-binding protein, NELL2 is expressed abundantly in neural tissues and may play important roles in the development of neural tissues. Also, NELL protein contains six epidermal growth factor (EGF)-like repeat domains that participate in calcium binding.
Product Categories/Family for anti-NELL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91,167 Da
NCBI Official Full Name
protein kinase C-binding protein NELL2 isoform b
NCBI Official Synonym Full Names
neural EGFL like 2
NCBI Official Symbol
NELL2
NCBI Official Synonym Symbols
NRP2
NCBI Protein Information
protein kinase C-binding protein NELL2
UniProt Protein Name
Protein kinase C-binding protein NELL2
UniProt Gene Name
NELL2
UniProt Synonym Gene Names
NRP2

NCBI Description

The protein encoded by this gene is a glycoprotein containing several von Willebrand factor C domains and epidermal growth factor (EGF)-like domains. The encoded protein acts as a homotrimer and is found in the cytoplasm. Several variants encoding a few different isoforms exist, and at least one isoform appears to be a secreted protein. Studies in mouse suggest that this protein plays a role in neural cell growth and differentiation as well as in oncogenesis. [provided by RefSeq, Feb 2009]

Uniprot Description

Required for neuron survival through the modulation of MAPK pathways (). Involved in the regulation of hypothalamic GNRH secretion and the control of puberty ().

Research Articles on NELL2

Similar Products

Product Notes

The NELL2 nell2 (Catalog #AAA6191407) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NELL2 (Protein Kinase C-binding Protein NELL2, MEL91 Protein, NEL-like Protein 2, Mel91) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NELL2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NELL2 nell2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NELL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.