Mouse anti-Human MAP2K1 Monoclonal Antibody | anti-MAP2K1 antibody

MAP2K1 (Mitogen-activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAPK/ERK Kinase 1, MEK1, MAPKK 1, MAPKK1, MEK 1, MKK1, Dual Specificity Mitogen-activated Protein Kinase Kinase 1, ERK Activator Kinase 1, PRKMK1) (Biotin)

Cat. Num. AAA6142803

• Gene Names: MAP2K1; CFC3; MEK1; MKK1; MAPKK1; PRKMK1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MAP2K1; Monoclonal Antibody; MAP2K1 (Mitogen-activated Protein Kinase Kinase 1; MAP Kinase Kinase 1; MAPK/ERK Kinase 1; MEK1; MAPKK 1; MAPKK1; MEK 1; MKK1; Dual Specificity Mitogen-activated Protein Kinase Kinase 1; ERK Activator Kinase 1; PRKMK1) (Biotin); anti-MAP2K1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B5
• Specificity: Recognizes human MAP2K1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-MAP2K1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa294-393, from human MAP2K1 (NP_002746) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-MAP2K1 antibody

MEK1 is an integral component of the MAP kinase cascade that regulates cell growth and differentiation and this pathway also plays a key role in synaptic plasticity in brain. Activated MEK1 acts as a dual specificity kinase phosphorylating both a threonine and a tyrosine residue on MAP kinase. Conversely there also appears to be a feedback phosphorylation of MEK1 by MAP kinase. The sites on MEK1 that are phosphorylated by MAP kinase are Thr292 and Thr386. human MEK1 gene is localized on chromosomal region 15q22.1-q22.33.

Product Categories/Family for anti-MAP2K1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 5579478
• NCBI GeneID: 5604
• NCBI Accession #: NP_002746
• NCBI GenBank Nucleotide #: NM_002755
• UniProt Accession #: Q0VD16; F2Z4G4; Q02750
• Molecular Weight: Predicted: 43 kDa; Observed: 44 kDa
• NCBI Official Full Name: dual specificity mitogen-activated protein kinase kinase 1
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase 1
• NCBI Official Symbol: MAP2K1
• NCBI Official Synonym Symbols: CFC3; MEK1; MKK1; MAPKK1; PRKMK1
• NCBI Protein Information: dual specificity mitogen-activated protein kinase kinase 1
• UniProt Protein Name: MAP2K1 protein
• UniProt Gene Name: MAP2K1
• UniProt Entry Name: Q0VD16_BOVIN

NCBI Description

The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development. [provided by RefSeq, Jul 2008]