Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse HEY2 Monoclonal Antibody | anti-HEY2 antibody

HEY2 (Hairy/Enhancer-of-Split Related with YRPW Motif 2, CHF1, GRIDLOCK, GRL, HERP1, HESR2, HRT2, MGC10720, bHLHb32) (MaxLight 750)

Gene Names
HEY2; GRL; CHF1; HRT2; HERP1; HESR2; bHLHb32; GRIDLOCK
Applications
Western Blot
Purity
Purified
Synonyms
HEY2; Monoclonal Antibody; HEY2 (Hairy/Enhancer-of-Split Related with YRPW Motif 2; CHF1; GRIDLOCK; GRL; HERP1; HESR2; HRT2; MGC10720; bHLHb32) (MaxLight 750); Hairy/Enhancer-of-Split Related with YRPW Motif 2; bHLHb32; anti-HEY2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B10
Specificity
Recognizes HEY2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-HEY2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HEY2 (NP_036391.1, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKG
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-HEY2 antibody
This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repress transcription. Expression of this gene is induced by the Notch signal transduction pathway. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq]
Product Categories/Family for anti-HEY2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
hairy/enhancer-of-split related with YRPW motif protein 2
NCBI Official Synonym Full Names
hairy/enhancer-of-split related with YRPW motif 2
NCBI Official Symbol
HEY2
NCBI Official Synonym Symbols
GRL; CHF1; HRT2; HERP1; HESR2; bHLHb32; GRIDLOCK
NCBI Protein Information
hairy/enhancer-of-split related with YRPW motif protein 2; HRT-2; hCHF1; hHRT2; HESR-2; protein gridlock homolog; HES-related repressor protein 1; HES-related repressor protein 2; hairy-related transcription factor 2; cardiovascular helix-loop-helix facto
UniProt Protein Name
Hairy/enhancer-of-split related with YRPW motif protein 2
UniProt Gene Name
HEY2
UniProt Synonym Gene Names
BHLHB32; CHF1; GRL; HERP; HERP1; HRT2; hCHF1; bHLHb32; HESR-2; HRT-2; hHRT2
UniProt Entry Name
HEY2_HUMAN

NCBI Description

This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus and interact with a histone deacetylase complex to repress transcription. Expression of this gene is induced by the Notch signal transduction pathway. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

HEY2: Downstream effector of Notch signaling which may be required for cardiovascular development. Transcriptional repressor which binds preferentially to the canonical E box sequence 5'- CACGTG-3'. Represses transcription by the cardiac transcriptional activators GATA4 and GATA6. Belongs to the HEY family.

Chromosomal Location of Human Ortholog: 6q21

Cellular Component: nucleoplasm; Sin3 complex; transcriptional repressor complex; cytoplasm; nucleus

Molecular Function: protein dimerization activity; protein binding; sequence-specific DNA binding; histone deacetylase binding; transcription factor activity; transcription factor binding

Biological Process: cardiac muscle hypertrophy; transcription from RNA polymerase II promoter; Notch signaling pathway; cell fate commitment; ventricular cardiac muscle cell development; positive regulation of heart rate; negative regulation of transcription from RNA polymerase II promoter; protein-DNA complex assembly; regulation of auditory receptor cell differentiation; negative regulation of Notch signaling pathway; smooth muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; vasculogenesis; mesenchymal cell development; anterior/posterior axis specification; positive regulation of cardiac muscle cell proliferation

Research Articles on HEY2

Similar Products

Product Notes

The HEY2 hey2 (Catalog #AAA6238645) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HEY2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HEY2 hey2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HEY2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.