Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DLG5 Monoclonal Antibody | anti-DLG5 antibody

DLG5 (Disks Large Homolog 5, Discs Large Protein P-dlg, Placenta and Prostate DLG, KIAA0583, PDLG) (MaxLight 490)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DLG5; Monoclonal Antibody; DLG5 (Disks Large Homolog 5; Discs Large Protein P-dlg; Placenta and Prostate DLG; KIAA0583; PDLG) (MaxLight 490); anti-DLG5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A5
Specificity
Recognizes human DLG5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
1919
Applicable Applications for anti-DLG5 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1708-1810 from DLG5 (NP_004738) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DLG5 antibody
May play a role at the plasma membrane in the maintenance of the structure of epithelial cells and in the transmission of extracellular signals to the membrane and cytoskeleton.
Product Categories/Family for anti-DLG5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
disks large homolog 5
UniProt Protein Name
Disks large homolog 5
Protein Family
UniProt Gene Name
DLG5
UniProt Synonym Gene Names
KIAA0583; PDLG
UniProt Entry Name
DLG5_HUMAN

Uniprot Description

DLG5: May play a role at the plasma membrane in the maintenance of the structure of epithelial cells and in the transmission of extracellular signals to the membrane and cytoskeleton. Belongs to the MAGUK family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 10q23

Cellular Component: cell-cell adherens junction; cytoplasm; plasma membrane

Molecular Function: protein binding; receptor signaling complex scaffold activity; cytoskeletal protein binding; beta-catenin binding

Biological Process: establishment and/or maintenance of epithelial cell polarity; regulation of apoptosis; polarized epithelial cell differentiation; negative regulation of cell proliferation; apical protein localization; cell-cell adhesion; midbrain development; zonula adherens assembly; protein complex assembly; signal transduction

Disease: Inflammatory Bowel Disease 1

Similar Products

Product Notes

The DLG5 dlg5 (Catalog #AAA6200486) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DLG5 (Disks Large Homolog 5, Discs Large Protein P-dlg, Placenta and Prostate DLG, KIAA0583, PDLG) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DLG5 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DLG5 dlg5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DLG5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.