Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse Beta Tubulin Monoclonal Antibody | anti-TUBB antibody

Anti-Beta Tubulin Antibody (Monoclonal, 5E4)

Gene Names
TUBB; M40; TUBB1; TUBB5; CDCBM6; CSCSC1; OK/SW-cl.56
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
Beta Tubulin; Monoclonal Antibody; Anti-Beta Tubulin Antibody (Monoclonal; 5E4); Tubulin beta chain; Tubulin beta-5 chain; TUBB; TUBB5; OK/SW-cl.56; anti-TUBB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1
Clone Number
5E4
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
444
Applicable Applications for anti-TUBB antibody
Western Blot (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS)
Application Notes
WB: 0.1-0.5ug/ml (Human, Mouse, Rat)
ICC: 2ug/ml (Human)
IF: 2ug/ml (Human)
FC/FACS: 1-3ug/1x106 cells (Human)
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Related Product Information for anti-TUBB antibody
Description: Mouse IgG monoclonal antibody for Beta Tubulin detection. Tested with WB, ICC/IF, FCM in Human; Mouse; Rat.

Background: Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.
References
1. "Entrez Gene: TUBB tubulin, beta".
2. Volz A, Weiss E, Trowsdale J, Ziegler A (Jan 1994). "Presence of an expressed beta-tubulin gene (TUBB) in the HLA class I region may provide the genetic basis for HLA-linked microtubule dysfunction". Human Genetics. 93 (1): 42-6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tubulin beta chain isoform b
NCBI Official Synonym Full Names
tubulin beta class I
NCBI Official Symbol
TUBB
NCBI Official Synonym Symbols
M40; TUBB1; TUBB5; CDCBM6; CSCSC1; OK/SW-cl.56
NCBI Protein Information
tubulin beta chain
UniProt Protein Name
Tubulin beta chain
Protein Family
UniProt Gene Name
TUBB
UniProt Synonym Gene Names
TUBB5
UniProt Entry Name
TBB5_HUMAN

NCBI Description

This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13. [provided by RefSeq, Jun 2014]

Research Articles on TUBB

Similar Products

Product Notes

The TUBB tubb (Catalog #AAA1753232) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Beta Tubulin Antibody (Monoclonal, 5E4) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Beta Tubulin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS). WB: 0.1-0.5ug/ml (Human, Mouse, Rat) ICC: 2ug/ml (Human) IF: 2ug/ml (Human) FC/FACS: 1-3ug/1x106 cells (Human) Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the TUBB tubb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Beta Tubulin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.