Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Rat B4GALNT1 Monoclonal Antibody | anti-B4GALNT1 antibody

B4GALNT1 (Beta-1, 4-N-Acetyl-Galactosaminyl Transferase 1, GALGT, GALNACT) (MaxLight 405)

Gene Names
B4GALNT1; GALGT; SPG26; GALNACT; GalNAc-T
Reactivity
Human, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
B4GALNT1; Monoclonal Antibody; B4GALNT1 (Beta-1; 4-N-Acetyl-Galactosaminyl Transferase 1; GALGT; GALNACT) (MaxLight 405); anti-B4GALNT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5F9
Specificity
Recognizes human B4GALNT1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-B4GALNT1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa30-127 from human B4GALNT1 (NP_001469) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
APGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLS
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-B4GALNT1 antibody
GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.
Product Categories/Family for anti-B4GALNT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
beta-1,4 N-acetylgalactosaminyltransferase 1 isoform 1
NCBI Official Synonym Full Names
beta-1,4-N-acetyl-galactosaminyltransferase 1
NCBI Official Symbol
B4GALNT1
NCBI Official Synonym Symbols
GALGT; SPG26; GALNACT; GalNAc-T
NCBI Protein Information
beta-1,4 N-acetylgalactosaminyltransferase 1
UniProt Protein Name
Beta-1,4 N-acetylgalactosaminyltransferase 1
UniProt Gene Name
B4GALNT1
UniProt Synonym Gene Names
GALGT; SIAT2
UniProt Entry Name
B4GN1_HUMAN

NCBI Description

GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2013]

Uniprot Description

B4GALNT1: Involved in the biosynthesis of gangliosides GM2, GD2 and GA2. Belongs to the glycosyltransferase 2 family.

Protein type: EC 2.4.1.92; Membrane protein, integral; Glycan Metabolism - glycosphingolipid biosynthesis - ganglio series; Transferase

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: membrane; plasma membrane; integral to Golgi membrane

Molecular Function: (N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase activity

Biological Process: sequestering of lipid; carbohydrate metabolic process; lipid glycosylation; protein amino acid glycosylation; glycosphingolipid metabolic process; spermatogenesis; ganglioside biosynthetic process

Research Articles on B4GALNT1

Similar Products

Product Notes

The B4GALNT1 b4galnt1 (Catalog #AAA6189028) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The B4GALNT1 (Beta-1, 4-N-Acetyl-Galactosaminyl Transferase 1, GALGT, GALNACT) (MaxLight 405) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's B4GALNT1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the B4GALNT1 b4galnt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "B4GALNT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.