Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ARL8B Monoclonal Antibody | anti-ARL8B antibody

ARL8B (ADP-ribosylation Factor-like Protein 8B, ADP-ribosylation Factor-like Protein 10C, Novel Small G Protein Indispensable for Equal Chromosome Segregation 1, ARL10C, GIE1, FLJ10702)

Gene Names
ARL8B; Gie1; ARL10C
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ARL8B; Monoclonal Antibody; ARL8B (ADP-ribosylation Factor-like Protein 8B; ADP-ribosylation Factor-like Protein 10C; Novel Small G Protein Indispensable for Equal Chromosome Segregation 1; ARL10C; GIE1; FLJ10702); Anti -ARL8B (ADP-ribosylation Factor-like Protein 8B; anti-ARL8B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A2
Specificity
Recognizes human ARL8B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
Applicable Applications for anti-ARL8B antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Full length recombinant corresponding to aa1-187 from human ARL8B (AAH13131) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-ARL8B antibody
May play a role in lysosome motility. May play a role in chromosome segregation.
Product Categories/Family for anti-ARL8B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,539 Da
NCBI Official Full Name
ADP-ribosylation factor-like protein 8B
NCBI Official Synonym Full Names
ADP-ribosylation factor-like 8B
NCBI Official Symbol
ARL8B
NCBI Official Synonym Symbols
Gie1; ARL10C
NCBI Protein Information
ADP-ribosylation factor-like protein 8B; ADP-ribosylation factor-like 10C; ADP-ribosylation factor-like protein 10C; novel small G protein indispensable for equal chromosome segregation 1
UniProt Protein Name
ADP-ribosylation factor-like protein 8B
UniProt Gene Name
ARL8B
UniProt Synonym Gene Names
ARL10C; GIE1
UniProt Entry Name
ARL8B_HUMAN

Uniprot Description

Function: May play a role in lysosome motility (Ref.6). May play a role in chromosome segregation (Ref.1). Ref.1 Ref.6

Subunit structure: Interacts with tubulin. Ref.1

Subcellular location: Late endosome membrane. Lysosome membrane. Cytoplasm › cytoskeleton › spindle. Note: According to Ref.1, it localizes with microtubules at the spindle mid-zone during mitosis. Ref.1 Ref.6 Ref.7

Tissue specificity: Ubiquitously expressed. Ref.1

Sequence similarities: Belongs to the small GTPase superfamily. Arf family.

Research Articles on ARL8B

Similar Products

Product Notes

The ARL8B arl8b (Catalog #AAA649530) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARL8B (ADP-ribosylation Factor-like Protein 8B, ADP-ribosylation Factor-like Protein 10C, Novel Small G Protein Indispensable for Equal Chromosome Segregation 1, ARL10C, GIE1, FLJ10702) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARL8B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the ARL8B arl8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLALISRLLD WFRSLFWKEE MELTLVGLQY SGKTTFVNVI ASGQFSEDMI PTVGFNMRKV TKGNVTIKIW DIGGQPRFRS MWERYCRGVN AIVYMIDAAD REKIEASRNE LHNLLDKPQL QGIPVLVLGN KRDLPNALDE KQLIEKMNLS AIQDREICCY SISCKEKDNI DITLQWLIQH SKSRRS. It is sometimes possible for the material contained within the vial of "ARL8B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.