Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Mouse ALDH1L1 Monoclonal Antibody | anti-ALDH1L1 antibody

ALDH1L1 (Aldehyde Dehydrogenase Family 1 Member L1, 10-formyltetrahydrofolate Dehydrogenase, 10-FTHFDH, FTHFD, DKFZp781N0997) (MaxLight 490)

Gene Names
ALDH1L1; FDH; FTHFD; 10-fTHF; 10-FTHFDH
Reactivity
Human, Mouse
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ALDH1L1; Monoclonal Antibody; ALDH1L1 (Aldehyde Dehydrogenase Family 1 Member L1; 10-formyltetrahydrofolate Dehydrogenase; 10-FTHFDH; FTHFD; DKFZp781N0997) (MaxLight 490); anti-ALDH1L1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
3E9
Specificity
Recognizes human ALDH1L1. Species Crossreactivity: mouse
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-ALDH1L1 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa803-902 from human ALDH1L1 (NM_012190, NP_036322) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-ALDH1L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,394 Da
NCBI Official Full Name
cytosolic 10-formyltetrahydrofolate dehydrogenase isoform 2
NCBI Official Synonym Full Names
aldehyde dehydrogenase 1 family, member L1
NCBI Official Symbol
ALDH1L1
NCBI Official Synonym Symbols
FDH; FTHFD; 10-fTHF; 10-FTHFDH
NCBI Protein Information
cytosolic 10-formyltetrahydrofolate dehydrogenase
UniProt Protein Name
Cytosolic 10-formyltetrahydrofolate dehydrogenase
UniProt Gene Name
ALDH1L1
UniProt Synonym Gene Names
FTHFD; 10-FTHFDH; FDH
UniProt Entry Name
AL1L1_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, nicotinamide adenine dinucleotide phosphate (NADP+), and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family. Loss of function or expression of this gene is associated with decreased apoptosis, increased cell motility, and cancer progression. There is an antisense transcript that overlaps on the opposite strand with this gene locus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]

Uniprot Description

ALDH1L1: 2 isoforms of the human protein are produced by alternative splicing

Protein type: Cofactor and Vitamin Metabolism - one carbon pool by folate; Oxidoreductase; EC 1.5.1.6

Chromosomal Location of Human Ortholog: 3q21.3

Cellular Component: mitochondrion

Molecular Function: methyltransferase activity; aldehyde dehydrogenase (NAD) activity; formyltetrahydrofolate dehydrogenase activity; hydroxymethyl-, formyl- and related transferase activity; catalytic activity

Biological Process: methylation; biosynthetic process; one-carbon compound metabolic process; 10-formyltetrahydrofolate catabolic process

Research Articles on ALDH1L1

Similar Products

Product Notes

The ALDH1L1 aldh1l1 (Catalog #AAA6199491) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ALDH1L1 (Aldehyde Dehydrogenase Family 1 Member L1, 10-formyltetrahydrofolate Dehydrogenase, 10-FTHFDH, FTHFD, DKFZp781N0997) (MaxLight 490) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH1L1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ALDH1L1 aldh1l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ALDH1L1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.