Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human AIP1 Monoclonal Antibody | anti-AIP1 antibody

AIP1 (MAGI2, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 2, Atrophin-1-interacting Protein 1, AIP-1, Atrophin-1-interacting Protein A, Membrane-associated Guanylate Kinase Inverted 2, MAGI-2, ACVRINP1, KIAA0705) (MaxLight 40

Gene Names
MAGI2; AIP1; AIP-1; ARIP1; SSCAM; MAGI-2; NPHS15; ACVRIP1
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AIP1; Monoclonal Antibody; AIP1 (MAGI2; Membrane-associated Guanylate Kinase; WW and PDZ Domain-containing Protein 2; Atrophin-1-interacting Protein 1; AIP-1; Atrophin-1-interacting Protein A; Membrane-associated Guanylate Kinase Inverted 2; MAGI-2; ACVRINP1; KIAA0705) (MaxLight 40; anti-AIP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6C8
Specificity
Recognizes human MAGI2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
6975
Applicable Applications for anti-AIP1 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa519-628 from MAGI2 (NP_036433) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRV
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-AIP1 antibody
Atrophin-1 (AIP1) contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. This protein is brain specific, where it appears to be widely expressed in both neurons and glia.
Product Categories/Family for anti-AIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens membrane associated guanylate kinase, WW and PDZ domain containing 2 (MAGI2), transcript variant 1, mRNA
NCBI Official Synonym Full Names
membrane associated guanylate kinase, WW and PDZ domain containing 2
NCBI Official Symbol
MAGI2
NCBI Official Synonym Symbols
AIP1; AIP-1; ARIP1; SSCAM; MAGI-2; NPHS15; ACVRIP1
NCBI Protein Information
membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
UniProt Protein Name
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
Protein Family
UniProt Gene Name
MAGI2
UniProt Synonym Gene Names
ACVRINP1; AIP1; KIAA0705; AIP-1; MAGI-2
UniProt Entry Name
MAGI2_HUMAN

NCBI Description

The protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. [provided by RefSeq, Jul 2008]

Uniprot Description

AIP1: a scaffold molecule at synaptic junctions that apparently couples neurotransmitter receptors and cell adhesion proteins. Contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. Contains two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. This protein is brain specific, where it appears to be widely expressed in both neurons and glia. Enhances the ability of PTEN to suppress AKT1 activation. Two splice-variant isoforms have been described.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7q21

Cellular Component: protein complex; tight junction; perinuclear region of cytoplasm; cytoplasm; postsynaptic density; dendrite; late endosome; plasma membrane; synapse; nucleus

Molecular Function: signal transducer activity; protein binding; receptor signaling complex scaffold activity; beta-1 adrenergic receptor binding; SMAD binding; phosphatase binding

Biological Process: positive regulation of phosphoprotein phosphatase activity; negative regulation of activin receptor signaling pathway; negative regulation of cell proliferation; negative regulation of protein kinase B signaling cascade; protein heterooligomerization; positive regulation of receptor internalization; negative regulation of cell migration; receptor clustering; cytoplasmic transport

Research Articles on AIP1

Similar Products

Product Notes

The AIP1 magi2 (Catalog #AAA6188787) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AIP1 (MAGI2, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 2, Atrophin-1-interacting Protein 1, AIP-1, Atrophin-1-interacting Protein A, Membrane-associated Guanylate Kinase Inverted 2, MAGI-2, ACVRINP1, KIAA0705) (MaxLight 40 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AIP1 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AIP1 magi2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AIP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.