Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Monoglyceride lipase (Mgll) Recombinant Protein | Mgll recombinant protein

Recombinant Mouse Monoglyceride lipase (Mgll)

Gene Names
Mgll; Mgl; Magl; AA589436
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Monoglyceride lipase (Mgll); Recombinant Mouse Monoglyceride lipase (Mgll); Monoglyceride lipase; MGL; EC=3.1.1.23; Monoacylglycerol lipase; MAGL; Mgll recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-303aa; Full Length
Sequence
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Mgll recombinant protein
Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth
Product Categories/Family for Mgll recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.4 kDa
NCBI Official Full Name
monoglyceride lipase isoform c
NCBI Official Synonym Full Names
monoglyceride lipase
NCBI Official Symbol
Mgll
NCBI Official Synonym Symbols
Mgl; Magl; AA589436
NCBI Protein Information
monoglyceride lipase; monoacylglycerol lipase
UniProt Protein Name
Monoglyceride lipase
Protein Family
UniProt Gene Name
Mgll
UniProt Synonym Gene Names
MGL; MAGL
UniProt Entry Name
MGLL_MOUSE

NCBI Description

This gene encodes a monoglyceride lipase, which catalyzes the hydrolysis of monoglycerides into fatty acids and glycerol. This enzyme is also thought to hydrolyze the endocannabinoid 2-arachidonoylglycerol. Alternatively spliced transcript variants have been described. [provided by RefSeq, Oct 2009]

Uniprot Description

MGLL: Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth. Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family.

Protein type: Lipid Metabolism - glycerolipid; EC 3.1.1.23; Phospholipase

Cellular Component: nucleoplasm; axon; synapse

Molecular Function: protein homodimerization activity; hydrolase activity; acylglycerol lipase activity; lipid binding

Biological Process: regulation of inflammatory response; arachidonic acid metabolic process; regulation of signal transduction; regulation of axon extension; lipid metabolic process; regulation of sensory perception of pain; fatty acid metabolic process; lipid catabolic process; fatty acid biosynthetic process; acylglycerol catabolic process

Research Articles on Mgll

Similar Products

Product Notes

The Mgll mgll (Catalog #AAA1108001) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-303aa; Full Length. The amino acid sequence is listed below: MPEASSPRRT PQNVPYQDLP HLVNADGQYL FCRYWKPSGT PKALIFVSHG AGEHCGRYDE LAHMLKGLDM LVFAHDHVGH GQSEGERMVV SDFQVFVRDV LQHVDTIQKD YPDVPIFLLG HSMGGAISIL VAAERPTYFS GMVLISPLVL ANPESASTLK VLAAKLLNFV LPNMTLGRID SSVLSRNKSE VDLYNSDPLV CRAGLKVCFG IQLLNAVARV ERAMPRLTLP FLLLQGSADR LCDSKGAYLL MESSRSQDKT LKMYEGAYHV LHRELPEVTN SVLHEVNSWV SHRIAAAGAG CPP . It is sometimes possible for the material contained within the vial of "Monoglyceride lipase (Mgll), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.