Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein Mdm4 (MDM4) Recombinant Protein | MDM4 recombinant protein

Recombinant Bovine Protein Mdm4 (MDM4)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein Mdm4 (MDM4); Recombinant Bovine Protein Mdm4 (MDM4); MDM4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-491, full length protein
Sequence
MTSFSTSAPCSAPDSARRISPEQTNQVRPKLPLLKILQAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATAATDAAQTLAIAQEHSMDIPSQDHLKQSVEESSNSRKRTEEGNIPTLPTSQYKCKNSREDEDLVANLTQEETSRLDLGFEEWDVAGLPWWFLGNLRNNYTPRSNGSTDLQTNQDIGTAIVSDTTDDLWFLNESVSEQFGVGKKVEAADPEQTSEEVGKLIDKKVTEVGKNDDLEDPKSISDDTDIEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKQESEGVDVPDCRRTVSAPVVRPKDTYVKEESSKHFDPCNSVEFLDLAHSSESQETISSMGEQSDNLFEQRKDTENMEDCQNLLKPCSLCEKRPRNGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFVA
Sequence Length
491
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MDM4 recombinant protein
The human MDM4 gene, which plays a role in apoptosis, encodes a 490-amino acid protein containing a RING finger domain and a putative nuclear localization signal. The MDM4 putative nuclear localization signal, which all Mdm proteins contain, is located in the C-terminal region of the protein. The mRNA is expressed at a high level in thymus and at lower levels in all other tissues tested. MDM4 protein produced by in vitro translation interacts with p53 via a binding domain located in the N-terminal region of the MDM4 protein. MDM4 shows significant structural similarity to p53-binding protein MDM2. Two transcript variants, one protein-coding and the other likely not to be protein-coding, have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,180 Da
NCBI Official Full Name
protein Mdm4
NCBI Official Synonym Full Names
MDM4, p53 regulator
NCBI Official Symbol
MDM4
NCBI Protein Information
protein Mdm4
UniProt Protein Name
Protein Mdm4
Protein Family
UniProt Gene Name
MDM4
UniProt Synonym Gene Names
MDMX

Uniprot Description

Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions ().

Similar Products

Product Notes

The MDM4 mdm4 (Catalog #AAA1431182) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-491, full length protein. The amino acid sequence is listed below: MTSFSTSAPC SAPDSARRIS PEQTNQVRPK LPLLKILQAA GAQGEMFTVK EVMHYLGQYI MVKQLYDQQE QHMVYCGGDL LGELLGRQSF SVKDPSPLYD MLRKNLVTLA TAATDAAQTL AIAQEHSMDI PSQDHLKQSV EESSNSRKRT EEGNIPTLPT SQYKCKNSRE DEDLVANLTQ EETSRLDLGF EEWDVAGLPW WFLGNLRNNY TPRSNGSTDL QTNQDIGTAI VSDTTDDLWF LNESVSEQFG VGKKVEAADP EQTSEEVGKL IDKKVTEVGK NDDLEDPKSI SDDTDIEVTS EDEWQCTECK KFNSPSKRYC FRCWALRKDW YSDCSKLTHS LSTSDITAIP EKQESEGVDV PDCRRTVSAP VVRPKDTYVK EESSKHFDPC NSVEFLDLAH SSESQETISS MGEQSDNLFE QRKDTENMED CQNLLKPCSL CEKRPRNGNI IHGRTGHLVT CFHCARRLKK AGASCPICKK EIQLVIKVFV A. It is sometimes possible for the material contained within the vial of "Protein Mdm4 (MDM4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.