SNF1-related protein kinase regulatory subunit beta-1 (KINB1) Recombinant Protein | KINB1 recombinant protein
Recombinant Arabidopsis thaliana SNF1-related protein kinase regulatory subunit beta-1 (KINB1)
Gene Names
AKINBETA1; KINbeta1; T10F18.200; T10F18_200
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
SNF1-related protein kinase regulatory subunit beta-1 (KINB1); Recombinant Arabidopsis thaliana SNF1-related protein kinase regulatory subunit beta-1 (KINB1); KINB1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-283, Full length protein
Sequence
MGNANGKDEDAAAGSGGADVTSSSARSNGGDPSARSRHRRPSSDSMSSSPPGSPARSPSPFLFAPQVPVAPLQRANAPPPNNIQWNQSQRVFDNPPEQGIPTIITWNQGGNDVAVEGSWDNWRSRKKLQKSGKDHSILFVLPSGIYHYKVIVDGESKYIPDLPFVADEVGNVCNILDVHNFVPENPESIVEFEAPPSPDHSYGQTLPAAEDYAKEPLAVPPQLHLTLLGTTEETAIATKPQHVVLNHVFIEQGWTPQSIVALGLTHRFESKYITVVLYKPLTR
Sequence Length
283
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,724 Da
NCBI Official Full Name
5'-AMP-activated protein kinase beta-2 subunit protein
NCBI Official Symbol
AKINBETA1
NCBI Official Synonym Symbols
KINbeta1; T10F18.200; T10F18_200
NCBI Protein Information
5'-AMP-activated protein kinase beta-2 subunit protein
UniProt Protein Name
SNF1-related protein kinase regulatory subunit beta-1
Protein Family
UniProt Gene Name
KINB1
UniProt Synonym Gene Names
AKIN subunit beta-1; AKINB1; AKINbeta1
NCBI Description
Encodes AKINbeta1, a subunit of the SnRK1 kinase (Sucrose non-fermenting-1-related protein kinase). Involved in regulation of nitrogen and sugar metabolism.
Uniprot Description
Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants. The SnRK complex may also be involved in the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase and in assimilation of nitrogen by phosphorylating nitrate reductase.
Research Articles on KINB1
Similar Products
Product Notes
The KINB1 kinb1 (Catalog #AAA1421621) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-283, Full length protein. The amino acid sequence is listed below: MGNANGKDED AAAGSGGADV TSSSARSNGG DPSARSRHRR PSSDSMSSSP PGSPARSPSP FLFAPQVPVA PLQRANAPPP NNIQWNQSQR VFDNPPEQGI PTIITWNQGG NDVAVEGSWD NWRSRKKLQK SGKDHSILFV LPSGIYHYKV IVDGESKYIP DLPFVADEVG NVCNILDVHN FVPENPESIV EFEAPPSPDH SYGQTLPAAE DYAKEPLAVP PQLHLTLLGT TEETAIATKP QHVVLNHVFI EQGWTPQSIV ALGLTHRFES KYITVVLYKP LTR. It is sometimes possible for the material contained within the vial of "SNF1-related protein kinase regulatory subunit beta-1 (KINB1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
