Voltage-gated potassium channel subunit beta-3 (Kcnab3) Recombinant Protein | Kcnab3 recombinant protein
Recombinant Mouse Voltage-gated potassium channel subunit beta-3 (Kcnab3)
Gene Names
Kcnab3; Kcnab4; mKv(beta)4; C330022D06Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Voltage-gated potassium channel subunit beta-3 (Kcnab3); Recombinant Mouse Voltage-gated potassium channel subunit beta-3 (Kcnab3); Kcnab3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-249, Full length protein
Sequence
MSRGYGLIFSLKVVFTFLSLPHPPGLQGSLDRLQLEYVDIVFANRSDPNSPMEEIVRAMTYVINQGLALYWGTSRWSAAEIMEAYSMARQFNLIPPVCEQAENHFFQREKVEMQLPELYHKIGVGSVTWSPLACGLITSKYDGRVPDTCKATVKGYQWLKEKVQSEEGKKQQARVMDLLPTARQLGCTVGQLAIAWCLRSEGVSSVLLGVSSAEQLMEHLGSLQVLSQLTPQTVVEIDALLGNKSHSKK
Sequence Length
249
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Kcnab3 recombinant protein
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member and the KCNA5 gene product assemble into a heteromultimeric A-type channel that inactivates completely and is significantly faster than other A-type Kv channels.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
27,749 Da
NCBI Official Full Name
Voltage-gated potassium channel subunit beta-3
NCBI Official Synonym Full Names
potassium voltage-gated channel, shaker-related subfamily, beta member 3
NCBI Official Symbol
Kcnab3
NCBI Official Synonym Symbols
Kcnab4; mKv(beta)4; C330022D06Rik
NCBI Protein Information
voltage-gated potassium channel subunit beta-3
UniProt Protein Name
Voltage-gated potassium channel subunit beta-3
Protein Family
UniProt Gene Name
Kcnab3
Uniprot Description
Accessory potassium channel protein which modulates the activity of the pore-forming alpha subunit. Alters the functional properties of Kv2.2 but not Kv2.1.
Similar Products
Product Notes
The Kcnab3 kcnab3 (Catalog #AAA954665) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-249, Full length protein. The amino acid sequence is listed below: MSRGYGLIFS LKVVFTFLSL PHPPGLQGSL DRLQLEYVDI VFANRSDPNS PMEEIVRAMT YVINQGLALY WGTSRWSAAE IMEAYSMARQ FNLIPPVCEQ AENHFFQREK VEMQLPELYH KIGVGSVTWS PLACGLITSK YDGRVPDTCK ATVKGYQWLK EKVQSEEGKK QQARVMDLLP TARQLGCTVG QLAIAWCLRS EGVSSVLLGV SSAEQLMEHL GSLQVLSQLT PQTVVEIDAL LGNKSHSKK. It is sometimes possible for the material contained within the vial of "Voltage-gated potassium channel subunit beta-3 (Kcnab3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
