Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Potassium voltage-gated channel subfamily A member 3 (Kcna3) Recombinant Protein | Kcna3 recombinant protein

Recombinant Rat Potassium voltage-gated channel subfamily A member 3 (Kcna3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium voltage-gated channel subfamily A member 3 (Kcna3); Recombinant Rat Potassium voltage-gated channel subfamily A member 3 (Kcna3); Recombinant Potassium voltage-gated channel subfamily A member 3 (Kcna3); Potassium voltage-gated channel subfamily A member 3; RCK3 RGK5 Voltage-gated potassium channel subunit Kv1.3 Voltage-gated potassium channel subunit Kv3; Kcna3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
: 1-184. Partial.
Sequence
MTVVPGDHLLEPEAAGGGGGDPPQGGCVSGGGCDRYEPLPPALPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDR NRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPAR
Sequence Length
184
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,425 Da
NCBI Official Full Name
potassium voltage-gated channel subfamily A member 3
NCBI Official Synonym Full Names
potassium voltage-gated channel, shaker-related subfamily, member 3
NCBI Official Symbol
Kcna3
NCBI Protein Information
potassium voltage-gated channel subfamily A member 3; KV3; RCK3; RGK5; voltage-gated potassium channel subunit Kv3; voltage-gated potassium channel subunit Kv1.3; potassium voltage gated channel, shaker related subfamily, member 3
UniProt Protein Name
Potassium voltage-gated channel subfamily A member 3
UniProt Gene Name
Kcna3
UniProt Entry Name
KCNA3_RAT

NCBI Description

encodes a lymphocyte potassium channel [RGD, Feb 2006]

Uniprot Description

Function: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.

Subunit structure: Heterotetramer of potassium channel proteins

By similarity. Binds PDZ domains of DLG1, DLG2 and DLG4.

Subcellular location: Membrane; Multi-pass membrane protein.

Domain: The N-terminus may be important in determining the rate of inactivation of the channel while the tail may play a role in modulation of channel activity and/or targeting of the channel to specific subcellular compartments.The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.

Sequence similarities: Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.3/KCNA3 sub-subfamily. [View classification]

Research Articles on Kcna3

Similar Products

Product Notes

The Kcna3 kcna3 (Catalog #AAA718598) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is : 1-184. Partial. The amino acid sequence is listed below: MTVVPGDHLL EPEAAGGGGG DPPQGGCVSG GGCDRYEPLP PALPAAGEQD CCGERVVINI SGLRFETQLK TLCQFPETLL GDPKRRMRYF DPLRNEYFFD R NRPSFDA ILYYYQSGGR IRRPVNVPID IFSEEIRFYQ LGEEAMEKFR EDEGFLREEE RPLPRRDFQR QVWLLFEYPE SSGPAR . It is sometimes possible for the material contained within the vial of "Potassium voltage-gated channel subfamily A member 3 (Kcna3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.