Endoglin Active Protein | Eng active protein

Recombinant Mouse Endoglin

Cat. Num. AAA142300

• Gene Names: Eng; Endo; CD105; AI528660; AI662476; S-endoglin
• Purity: Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Synonyms: Endoglin; Recombinant Mouse Endoglin; Endoglin Mouse; Endoglin Mouse Recombinant; CD105; ENG; END; ORW; HHT1; ORW1; FLJ41744; Cell surface MJ7/18 antigen; mEndoglin; Eng active protein

• Host: Insect Cells
• Purity/Purification: Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Form/Format: Endoglin was lyophilized from a concentrated (1mg/ml) sterile solution containing no additives.; Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS
• Sequence Length: 653

• Solubility: It is recommended to reconstitute the lyophilized CD-105 in sterile PBS not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
• Biological Activity: Measured by its ability to bind with rhTGF-beta RII/Fc in a functional ELISA. Optimal dilutions should be determined by each laboratory for each application.
• Preparation and Storage: Lyophilized Endoglin although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CD105 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Related Product Information for Eng active protein

Description: CD105 Mouse Recombinant extracellular domain produced in baculovirus is a homodimeric, glycosylated, Polypeptide containing 581 amino acids and having a molecular mass of 61 kDa but as a result of glycosylation, migrates at 75-85 kDa under reducing conditions in SDS-PAGE. Based on N-terminal sequence analysis, the primary structure of recombinant mature Endoglin starts at Glu 26. The CD105 is fused to a C-terminal His-tag (6xHis) and purified by proprietary chromatographic techniques.

Introduction: Endoglin is a type I membrane glycoprotein located on cell surfaces and is part of the TGF beta receptor complex.The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts, and smooth muscle cells. Endoglin has been found to be part of the TGF-beta1 receptor complex. It thus may be involved in the binding of TGF-beta1, TGF-beta3, activin-A, BMP-2, and BMP-7. Beside TGF-beta signaling endoglin may have other functions. It has been postulated that endoglin is involved in the cytoskeletal organization affecting cell morphology and migration. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling. Its expression is regulated during heart development. Experimental mice without the endoglin gene die due to cardiovascular abnormalities.

Product Categories/Family for Eng active protein

Cytokines and Growth Factors; Cytokines; Endoglin

NCBI and Uniprot Product Information

• NCBI GI #: 226437647
• NCBI GeneID: 13805
• NCBI Accession #: NP_031958.2
• NCBI GenBank Nucleotide #: NM_007932.2
• UniProt Accession #: Q63961; Q61520; Q8K100
• Molecular Weight: 70,021 Da
• NCBI Official Full Name: endoglin isoform 1
• NCBI Official Synonym Full Names: endoglin
• NCBI Official Symbol: Eng
• NCBI Official Synonym Symbols: Endo; CD105; AI528660; AI662476; S-endoglin
• NCBI Protein Information: endoglin; cell surface MJ7/18 antigen; transmembrane glycoprotein
• UniProt Protein Name: Endoglin
• Protein Family: Endoglin
• UniProt Gene Name: Eng
• UniProt Synonym Gene Names: Edg
• UniProt Entry Name: EGLN_MOUSE

Uniprot Description

ENG: Major glycoprotein of vascular endothelium. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. Homodimer that forms an heteromeric complex with the signaling receptors for transforming growth factor-beta: TGFBR1 and/or TGFBR2. It is able to bind TGF-beta 1, and 3 efficiently and TGF-beta 2 less efficiently. Interacts with TCTEX1D4. Interacts with ARRB2. Endoglin is restricted to endothelial cells in all tissues except bone marrow. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral; Motility/polarity/chemotaxis

Cellular Component: nucleoplasm; extracellular space; cell surface; focal adhesion; membrane; cytoplasm; integral to membrane; receptor complex; external side of plasma membrane

Molecular Function: transforming growth factor beta receptor activity; protein binding; glycosaminoglycan binding; protein homodimerization activity; transforming growth factor beta binding; galactose binding; punt binding; transforming growth factor beta receptor, cytoplasmic mediator activity

Biological Process: wound healing; heart development; positive regulation of collagen biosynthetic process; cell motility involved in cell locomotion; positive regulation of systemic arterial blood pressure; negative regulation of transcription from RNA polymerase II promoter; protein amino acid phosphorylation; smooth muscle development; extracellular matrix disassembly; regulation of transforming growth factor beta receptor signaling pathway; central nervous system vasculogenesis; venous blood vessel morphogenesis; regulation of transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; transmembrane receptor protein serine/threonine kinase signaling pathway; negative regulation of protein amino acid autophosphorylation; heart looping; angiogenesis; vasculogenesis; cell adhesion; negative regulation of cell migration; positive regulation of BMP signaling pathway; cell migration; negative regulation of nitric-oxide synthase activity; patterning of blood vessels; positive regulation of angiogenesis; negative regulation of endothelial cell proliferation; response to hypoxia; artery morphogenesis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation