Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

U2AF1L4 blocking peptide

U2AF1L4 Peptide - N-terminal region

Gene Names
U2AF1L4; U2af26; U2AF1L3; U2AF1RS3; U2AF1-RS3; U2AF1L3V1
Reactivity
Human
Applications
Western Blot
Synonyms
U2AF1L4; U2AF1L4 Peptide - N-terminal region; U2AF1L4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDV
Sequence Length
220
Applicable Applications for U2AF1L4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for U2AF1L4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-U2AF1L4 Antibody, made

Target Description: U2AF1L4 is a RNA-binding protein that function as a pre-mRNA splicing factor. It plays a critical role in both constitutive and enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required for accurate 3'-splice site selection. It acts by enhancing the binding of U2AF2 to weak pyrimidine tracts and also participates in the regulation of alternative pre-mRNA splicing. It activates exon 5 skipping of PTPRC during T-cell activation; an event reversed by GFI1. U2AF1L4 binds to RNA at the AG dinucleotide at the 3'-splice site.
Product Categories/Family for U2AF1L4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
splicing factor U2AF 26 kDa subunit isoform 1
NCBI Official Synonym Full Names
U2 small nuclear RNA auxiliary factor 1 like 4
NCBI Official Symbol
U2AF1L4
NCBI Official Synonym Symbols
U2af26; U2AF1L3; U2AF1RS3; U2AF1-RS3; U2AF1L3V1
NCBI Protein Information
splicing factor U2AF 26 kDa subunit
UniProt Protein Name
Splicing factor U2AF 26 kDa subunit
Protein Family
UniProt Gene Name
U2AF1L4
UniProt Synonym Gene Names
U2AF1-RS3; U2AF1L3; U2 small nuclear RNA auxiliary factor 1-like protein 3
UniProt Entry Name
U2AF4_HUMAN

Research Articles on U2AF1L4

Similar Products

Product Notes

The U2AF1L4 u2af1l4 (Catalog #AAA3230112) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The U2AF1L4 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's U2AF1L4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the U2AF1L4 u2af1l4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KIGVCRHGDR CSRLHNKPTF SQTIVLLNLY RNPQNTAQTA DGSHCHVSDV. It is sometimes possible for the material contained within the vial of "U2AF1L4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.