Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RAB25 blocking peptide

RAB25 Peptide - C-terminal region

Gene Names
RAB25; CATX-8; RAB11C
Reactivity
Human
Synonyms
RAB25; RAB25 Peptide - C-terminal region; RAB25 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEKRACC
Sequence Length
213
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RAB25 blocking peptide
This is a synthetic peptide designed for use in combination with anti- RAB25 Antibody, made

Target Description: The protein encoded by this gene is a member of the RAS superfamily of small GTPases. The encoded protein is involved in membrane trafficking and cell survival. This gene has been found to be a tumor suppressor and an oncogene, depending on the context. Two variants, one protein-coding and the other not, have been found for this gene.
Product Categories/Family for RAB25 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23 kDa
NCBI Official Full Name
ras-related protein Rab-25
NCBI Official Synonym Full Names
RAB25, member RAS oncogene family
NCBI Official Symbol
RAB25
NCBI Official Synonym Symbols
CATX-8; RAB11C
NCBI Protein Information
ras-related protein Rab-25
UniProt Protein Name
Ras-related protein Rab-25
Protein Family
UniProt Gene Name
RAB25
UniProt Synonym Gene Names
CATX8
UniProt Entry Name
RAB25_HUMAN

NCBI Description

The protein encoded by this gene is a member of the RAS superfamily of small GTPases. The encoded protein is involved in membrane trafficking and cell survival. This gene has been found to be a tumor suppressor and an oncogene, depending on the context. Two variants, one protein-coding and the other not, have been found for this gene. [provided by RefSeq, Nov 2015]

Uniprot Description

Function: Involved in the regulation of cell survival. Promotes invasive migration of cells in which it functions to localize and maintain integrin alpha-V/beta-1 at the tips of extending pseudopodia. Increases the rates of ovarian and breast cancers progression and aggressiveness by modulating cellular processes such as proliferation, survival and migration of epithelial tumor cells. May selectively regulate the apical recycling pathway. Together with MYO5B regulates transcytosis

By similarity. Ref.7 Ref.8

Subunit structure: Interacts with RAB11FIP1, RAB11FIP2, RAB11FIP3 and RAB11FIP4. Interacts (via the hypervariable C-terminal region) with ITGB1 (via the cytoplasmic region); the interaction is GTP-dependent. Interacts with ITGAV. Associates with the integrin alpha-V/beta-1 heterodimer. Ref.6 Ref.8

Subcellular location: Cell membrane; Lipid-anchor; Cytoplasmic side

Potential. Cell projection › pseudopodium membrane. Cytoplasmic vesicle. Note: Colocalizes with integrin alpha-V/beta-1 in vesicles at the pseudopodial tips.

Tissue specificity: Expressed in ovarian epithelium (NOE) and breast tissue. Expressed in ovarian cancer; expression is increased relative to NOE cells. Expression in ovarian cancer is stage dependent, with stage III and stage IV showing higher levels than early stage cancers. Expressed in breast cancer; expression is increased relative to normal breast tissue. Ref.7

Sequence similarities: Belongs to the small GTPase superfamily. Rab family.

Sequence caution: The sequence AAF98238.1 differs from that shown. Reason: Frameshift at position 196. The sequence AAM69362.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on RAB25

Similar Products

Product Notes

The RAB25 rab25 (Catalog #AAA3246421) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RAB25 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVELAFETVL KEIFAKVSKQ RQNSIRTNAI TLGSAQAGQE PGPGEKRACC. It is sometimes possible for the material contained within the vial of "RAB25, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.