NUDT2 blocking peptide

NUDT2 Peptide - middle region

Cat. Num. AAA3247537

• Gene Names: NUDT2; APAH1
• Reactivity: Human
• Synonyms: NUDT2; NUDT2 Peptide - middle region; NUDT2 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: KVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEA
• Sequence Length: 147

• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for NUDT2 blocking peptide

This is a synthetic peptide designed for use in combination with anti- NUDT2 Antibody, made

Target Description: This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified.

Product Categories/Family for NUDT2 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 4502125
• NCBI GeneID: 318
• NCBI Accession #: NP_001152.1
• NCBI GenBank Nucleotide #: NM_001161.4
• UniProt Accession #: P50583
• Molecular Weight: 16 kDa
• NCBI Official Full Name: bis(5'-nucleosyl)-tetraphosphatase
• NCBI Official Synonym Full Names: nudix hydrolase 2
• NCBI Official Symbol: NUDT2
• NCBI Official Synonym Symbols: APAH1
• NCBI Protein Information: bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
• UniProt Protein Name: Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
• Protein Family: Nudix hydrolase
• UniProt Gene Name: NUDT2
• UniProt Synonym Gene Names: APAH1; Ap4A hydrolase; Ap4Aase; Diadenosine tetraphosphatase; Nudix motif 2
• UniProt Entry Name: AP4A_HUMAN

NCBI Description

This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. [provided by RefSeq, Sep 2011]

Uniprot Description

NUDT2: Asymmetrically hydrolyzes Ap4A to yield AMP and ATP. Plays a major role in maintaining homeostasis. Belongs to the Nudix hydrolase family.

Protein type: Hydrolase; Nucleotide Metabolism - pyrimidine; Apoptosis; Nucleotide Metabolism - purine; EC 3.6.1.17

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: mitochondrion

Molecular Function: GTP binding; bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity; bis(5'-nucleosyl)-tetraphosphatase (symmetrical) activity

Biological Process: apoptosis; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process