Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MYO6 blocking peptide

MYO6 Peptide - C-terminal region

Gene Names
MYO6; DFNA22; DFNB37; Myo6-007; Myo6-008
Reactivity
Human
Synonyms
MYO6; MYO6 Peptide - C-terminal region; MYO6 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYA
Sequence Length
1294
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MYO6 blocking peptide
This is a synthetic peptide designed for use in combination with anti- MYO6 Antibody, made

Target Description: This gene encodes a reverse-direction motor protein that moves toward the minus end of actin filaments and plays a role in intracellular vesicle and organelle transport. The protein consists of a motor domain containing an ATP- and an actin-binding site and a globular tail which interacts with other proteins. This protein maintains the structural integrity of inner ear hair cells and mutations in this gene cause non-syndromic autosomal dominant and recessive hearing loss. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for MYO6 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
142 kDa
NCBI Official Full Name
unconventional myosin-VI isoform 2
NCBI Official Synonym Full Names
myosin VI
NCBI Official Symbol
MYO6
NCBI Official Synonym Symbols
DFNA22; DFNB37; Myo6-007; Myo6-008
NCBI Protein Information
unconventional myosin-VI
UniProt Protein Name
Unconventional myosin-VI
Protein Family
UniProt Gene Name
MYO6
UniProt Synonym Gene Names
KIAA0389
UniProt Entry Name
MYO6_HUMAN

NCBI Description

This gene encodes a reverse-direction motor protein that moves toward the minus end of actin filaments and plays a role in intracellular vesicle and organelle transport. The protein consists of a motor domain containing an ATP- and an actin-binding site and a globular tail which interacts with other proteins. This protein maintains the structural integrity of inner ear hair cells and mutations in this gene cause non-syndromic autosomal dominant and recessive hearing loss. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2014]

Uniprot Description

MYO6: a molecular motor involved in intracellular vesicle and organelle transport. It is one of the so-called unconventional myosins.

Protein type: Motility/polarity/chemotaxis; Actin-binding; Motor

Chromosomal Location of Human Ortholog: 6q13

Cellular Component: Golgi apparatus; nuclear membrane; microvillus; lysosomal membrane; cytoplasmic membrane-bound vesicle; clathrin coated vesicle membrane; coated pit; DNA-directed RNA polymerase II, holoenzyme; cell cortex; clathrin-coated endocytic vesicle; cytosol; nucleoplasm; filamentous actin; ruffle; cell soma; membrane; perinuclear region of cytoplasm; endocytic vesicle; apical part of cell; axon; cytoplasm; unconventional myosin complex; plasma membrane; nucleus

Molecular Function: actin filament binding; calmodulin binding; minus-end directed microfilament motor activity; protein binding; motor activity; actin binding; ADP binding; ATP binding

Biological Process: response to drug; inner ear morphogenesis; DNA damage response, signal transduction by p53 class mediator; metabolic process; actin filament-based movement; regulation of synaptic plasticity; auditory receptor cell differentiation; regulation of secretion; locomotory behavior; endocytosis; synaptic transmission; intracellular protein transport; synaptogenesis; sensory perception of sound; glutamate secretion; dendrite development; positive regulation of transcription from RNA polymerase II promoter; protein targeting

Disease: Deafness, Autosomal Recessive 37; Deafness, Autosomal Dominant 22

Research Articles on MYO6

Similar Products

Product Notes

The MYO6 myo6 (Catalog #AAA3248045) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MYO6 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPQQNPAAQI PARQREIEMN RQQRFFRIPF IRPADQYKDP QSKKKGWWYA. It is sometimes possible for the material contained within the vial of "MYO6, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.