Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

IKZF3 blocking peptide

IKZF3 Peptide - middle region

Gene Names
IKZF3; AIO; AIOLOS; ZNFN1A3
Reactivity
Human
Applications
Western Blot
Synonyms
IKZF3; IKZF3 Peptide - middle region; IKZF3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: YACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQS
Sequence Length
263
Applicable Applications for IKZF3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for IKZF3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-IKZF3 Antibody, made

Target Description: IKZF3 is a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoetic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. At least six alternative transcripts encoding different isoforms have been described.
Product Categories/Family for IKZF3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
zinc finger protein Aiolos isoform 7
NCBI Official Synonym Full Names
IKAROS family zinc finger 3
NCBI Official Symbol
IKZF3
NCBI Official Synonym Symbols
AIO; AIOLOS; ZNFN1A3
NCBI Protein Information
zinc finger protein Aiolos
UniProt Protein Name
Zinc finger protein Aiolos
Protein Family
UniProt Gene Name
IKZF3
UniProt Synonym Gene Names
ZNFN1A3
UniProt Entry Name
IKZF3_HUMAN

NCBI Description

This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. Several alternative transcripts encoding different isoforms have been described, as well as some non-protein coding variants. [provided by RefSeq, Apr 2012]

Uniprot Description

Aiolos: a transcription factor of the ikaros C2H2-type zinc-finger protein family. Plays an important role in the regulation of lymphocyte differentiation. Deletions in Aiolos have been observed in a subset of pre-B-cell acute lymphoblastic leukemia (B-ALL) cases. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: cytoplasm; plasma membrane; nucleus

Molecular Function: protein binding; protein homodimerization activity; protein heterodimerization activity; sequence-specific DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of apoptosis; regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; B cell activation; regulation of lymphocyte differentiation; regulation of B cell differentiation; regulation of B cell proliferation; mesoderm development

Research Articles on IKZF3

Similar Products

Product Notes

The IKZF3 ikzf3 (Catalog #AAA3229757) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The IKZF3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IKZF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IKZF3 ikzf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YACQRRDALT GHLRTHSVEK PYKCEFCGRS YKQRSSLEEH KERCRTFLQS. It is sometimes possible for the material contained within the vial of "IKZF3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.