Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

HLA-DOA blocking peptide

HLA-DOA Peptide - N-terminal region

Gene Names
HLA-DOA; HLADZ; HLA-DNA; HLA-DZA
Reactivity
Human
Synonyms
HLA-DOA; HLA-DOA Peptide - N-terminal region; HLA-DOA blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLK
Sequence Length
250
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for HLA-DOA blocking peptide
HLA-DOA belongs to the HLA class II alpha chain paralogues. HLA-DOA forms a heterodimer with HLA-DOB. The heterodimer, HLA-DO, is found in lysosomes in B cells and regulates HLA-DM-mediated peptide loading on MHC class II molecules. In comparison with classical HLA class II molecules, this gene exhibits very little sequence variation, especially at the protein level.
Product Categories/Family for HLA-DOA blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
HLA class II histocompatibility antigen, DO alpha chain
NCBI Official Synonym Full Names
major histocompatibility complex, class II, DO alpha
NCBI Official Symbol
HLA-DOA
NCBI Official Synonym Symbols
HLADZ; HLA-DNA; HLA-DZA
NCBI Protein Information
HLA class II histocompatibility antigen, DO alpha chain
UniProt Protein Name
HLA class II histocompatibility antigen, DO alpha chain
UniProt Gene Name
HLA-DOA
UniProt Synonym Gene Names
HLA-DNA; HLA-DZA
UniProt Entry Name
DOA_HUMAN

NCBI Description

HLA-DOA belongs to the HLA class II alpha chain paralogues. HLA-DOA forms a heterodimer with HLA-DOB. The heterodimer, HLA-DO, is found in lysosomes in B cells and regulates HLA-DM-mediated peptide loading on MHC class II molecules. In comparison with classical HLA class II molecules, this gene exhibits very little sequence variation, especially at the protein level. [provided by RefSeq, Jul 2008]

Uniprot Description

HLA-DOA: Important modulator in the HLA class II restricted antigen presentation pathway by interaction with the HLA-DM molecule in B-cells. Modifies peptide exchange activity of HLA-DM. Belongs to the MHC class II family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: lysosomal membrane; integral to membrane; plasma membrane; endosome membrane; MHC class II protein complex

Molecular Function: MHC class II receptor activity

Biological Process: negative regulation of antigen processing and presentation of peptide antigen via MHC class II; antigen processing and presentation of exogenous peptide antigen via MHC class II; immune response; regulation of T cell differentiation; signal transduction

Research Articles on HLA-DOA

Similar Products

Product Notes

The HLA-DOA hla-doa (Catalog #AAA3241634) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The HLA-DOA Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMTLLSPQEA GATKADHMGS YGPAFYQSYG ASGQFTHEFD EEQLFSVDLK. It is sometimes possible for the material contained within the vial of "HLA-DOA, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.