14-3-3-like protein GF14 kappa (GRF8) Recombinant Protein | GRF8 recombinant protein

Recombinant Arabidopsis thaliana 14-3-3-like protein GF14 kappa (GRF8)

Cat. Num. AAA1224312

• Gene Names: GRF8; 14-3-3 PROTEIN G-BOX FACTOR14 KAPPA; 14-3-3KAPPA; general regulatory factor 8; GF14 KAPPA; GF14 KAPPA ISOFORM; MNA5.16; MNA5_16
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: 14-3-3-like protein GF14 kappa (GRF8); Recombinant Arabidopsis thaliana 14-3-3-like protein GF14 kappa (GRF8); GRF8 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-248, Full length protein
• Sequence: MATTLSRDQYVYMAKLAEQAERYEEMVQFMEQLVSGATPAGELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRKNEEHVSLVKDYRSKVETELSSICSGILRLLDSHLIPSATASESKVFYLKMKGDYHRYLAEFKSGDERKTAAEDTMIAYKAAQDVAVADLAPTHPIRLGLALNFSVFYYEILNSSEKACSMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQEQMDEA
• Sequence Length: 248

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 30698124
• NCBI GeneID: 836668
• NCBI Accession #: NP_569012.2
• NCBI GenBank Nucleotide #: NM_125941.2
• UniProt Accession #: P48348; Q0WSB7; Q9SWP7
• Molecular Weight: 27,771 Da
• NCBI Official Full Name: general regulatory factor 8
• NCBI Official Symbol: GRF8
• NCBI Official Synonym Symbols: 14-3-3 PROTEIN G-BOX FACTOR14 KAPPA; 14-3-3KAPPA; general regulatory factor 8; GF14 KAPPA; GF14 KAPPA ISOFORM; MNA5.16; MNA5_16
• NCBI Protein Information: general regulatory factor 8
• UniProt Protein Name: 14-3-3-like protein GF14 kappa
• Protein Family: 14-3-3-like protein
• UniProt Gene Name: GRF8

NCBI Description

member of 14-3-3 proteins. This protein is reported to interact with the BZR1 transcription factor involved in brassinosteroid signaling and may affect the nucleocytoplasmic shuttling of BZR1

Uniprot Description

Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes. Involved in the regulation of nutrient metabolism (PubMed:22104211). Negative regulator of freezing tolerance that modulates cold-responsive C-repeat-binding factors (CBF) DREB1A AND DREB1B proteins stability by facilitating their ubiquitin-mediated degradation (PubMed:28344081).