G-protein coupled receptor 6 (Gpr6) Recombinant Protein | Gpr6 recombinant protein
Recombinant Rat G-protein coupled receptor 6 (Gpr6)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G-protein coupled receptor 6 (Gpr6); Recombinant Rat G-protein coupled receptor 6 (Gpr6); Recombinant G-protein coupled receptor 6 (Gpr6); G-protein coupled receptor 6; Sphingosine 1-phosphate receptor GPR6; Gpr6 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-363
Sequence
MNASAAALNESQVVAVAAEGAAAAATAAGTPDTSEWGPPAASAALGGGGGPNGSLELSSQLPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRASCSVVRPLTRSHVALLSTSFFVVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSPSEV
Sequence Length
363
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,115 Da
NCBI Official Full Name
G-protein coupled receptor 6
NCBI Official Synonym Full Names
G protein-coupled receptor 6
NCBI Official Symbol
Gpr6
NCBI Protein Information
G-protein coupled receptor 6; sphingosine 1-phosphate receptor GPR6; putative G protein-coupled receptor (CNL3)
UniProt Protein Name
G-protein coupled receptor 6
Protein Family
UniProt Gene Name
Gpr6
UniProt Synonym Gene Names
Cnl3
UniProt Entry Name
GPR6_RAT
NCBI Description
may mediate later differentiation events within the superficial cortical layers during cerebral cortical development [RGD, Feb 2006]
Uniprot Description
GPR6: Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Promotes neurite outgrowth and blocks myelin inhibition in neurons. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral; Receptor, GPCR
Cellular Component: cell; plasma membrane; integral to membrane; cytosol
Biological Process: G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration
Research Articles on Gpr6
Similar Products
Product Notes
The Gpr6 gpr6 (Catalog #AAA953046) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-363. The amino acid sequence is listed below: MNASAAALNE SQVVAVAAEG AAAAATAAGT PDTSEWGPPA ASAALGGGGG PNGSLELSSQ LPAGPSGLLL SAVNPWDVLL CVSGTVIAGE NALVVALIAS TPALRTPMFV LVGSLATADL LAGCGLILHF VFQYVVPSET VSLLMVGFLV ASFAASVSSL LAITVDRYLS LYNALTYYSR RTLLGVHLLL AATWTVSLGL GLLPVLGWNC LADRASCSVV RPLTRSHVAL LSTSFFVVFG IMLHLYVRIC QVVWRHAHQI ALQQHCLAPP HLAATRKGVG TLAVVLGTFG ASWLPFAIYC VVGSQEDPAI YTYATLLPAT YNSMINPIIY AFRNQEIQRA LWLLFCGCFQ SKVPFRSRSP SEV. It is sometimes possible for the material contained within the vial of "G-protein coupled receptor 6 (Gpr6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
