Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

G-protein coupled estrogen receptor 1 (Gper) Recombinant Protein | Gper recombinant protein

Recombinant Rat G-protein coupled estrogen receptor 1 (Gper)

Gene Names
Gper1; Gper; GPR41; Gpr30
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G-protein coupled estrogen receptor 1 (Gper); Recombinant Rat G-protein coupled estrogen receptor 1 (Gper); Gper recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-375aa; Full length protein
Sequence
MAATTPAQDVGVEIYLGPVWPAPSNSTPLALNLSLALREDAPGNLTGDLSEHQQYVIALF LSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAAADLILVADSLIEVFNLD EQYYDIAVLCTFMSLFLQINMYSSVFFLTWMSFDRYLALAKAMRCGLFRTKHHARLSCGL IWMASVSATLVPFTAVHLRHTEEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRA LIRAHRHRGLRPRRQKALRMIFAVVLVFFICWLPENVFISVHLLQWAQPGDTPCKQSFRH AYPLTGHIVNLAAFSNSCLSPLIYSFLGETFRDKLRLYVAQKTSLPALNRFCHATLKAVI PDSTEQSDVKFSSAV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Gper recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,260 Da
NCBI Official Full Name
G-protein coupled estrogen receptor 1
NCBI Official Synonym Full Names
G protein-coupled estrogen receptor 1
NCBI Official Symbol
Gper1
NCBI Official Synonym Symbols
Gper; GPR41; Gpr30
NCBI Protein Information
G-protein coupled estrogen receptor 1
UniProt Protein Name
G-protein coupled estrogen receptor 1
UniProt Gene Name
Gper1
UniProt Synonym Gene Names
Cmkrl2; Gper; Gpr30; Gpr41; mER
UniProt Entry Name
GPER1_RAT

NCBI Description

an orphan G protein-coupled receptor found in lung [RGD, Feb 2006]

Uniprot Description

GPER1: Receptor for estrogen. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR; Motility/polarity/chemotaxis

Cellular Component: axon; basolateral plasma membrane; cell junction; cytoplasm; cytoplasmic vesicle membrane; cytosol; dendrite; dendritic shaft; early endosome; endoplasmic reticulum; endoplasmic reticulum membrane; Golgi apparatus; Golgi membrane; integral to membrane; intracellular; keratin filament; mitochondrial membrane; nerve terminal; nuclear envelope; nucleus; perinuclear region of cytoplasm; plasma membrane; postsynaptic density; postsynaptic membrane; presynaptic active zone; presynaptic membrane; recycling endosome; trans-Golgi network

Molecular Function: chromatin binding; drug binding; estrogen receptor activity; G-protein coupled receptor activity; hormone binding; mineralocorticoid receptor activity; steroid binding; steroid hormone receptor activity

Biological Process: apoptotic chromosome condensation; cytosolic calcium ion homeostasis; elevation of cytosolic calcium ion concentration; G-protein coupled receptor protein signaling pathway; generation of action potential; inflammatory response; innate immune response; mineralocorticoid receptor signaling pathway; negative regulation of cell proliferation; negative regulation of DNA metabolic process; negative regulation of fat cell differentiation; negative regulation of inflammatory response; negative regulation of leukocyte activation; negative regulation of lipid biosynthetic process; negative regulation of protein kinase B signaling cascade; nuclear fragmentation during apoptosis; positive regulation of apoptosis; positive regulation of cAMP biosynthetic process; positive regulation of caspase activity; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of epidermal growth factor receptor signaling pathway; positive regulation of G-protein coupled receptor protein signaling pathway; positive regulation of inositol trisphosphate biosynthetic process; positive regulation of insulin secretion; positive regulation of MAPKKK cascade; positive regulation of neurogenesis; positive regulation of neurotransmitter secretion; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein amino acid phosphorylation; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of transcription from RNA polymerase II promoter; positive regulation of vasodilation; steroid hormone mediated signaling; steroid hormone receptor signaling pathway

Research Articles on Gper

Similar Products

Product Notes

The Gper gper1 (Catalog #AAA7016021) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-375aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Gper gper1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAATTPAQDV GVEIYLGPVW PAPSNSTPLA LNLSLALRED APGNLTGDLS EHQQYVIALF LSCLYTIFLF PIGFVGNILI LVVNISFREK MTIPDLYFIN LAAADLILVA DSLIEVFNLD EQYYDIAVLC TFMSLFLQIN MYSSVFFLTW MSFDRYLALA KAMRCGLFRT KHHARLSCGL IWMASVSATL VPFTAVHLRH TEEACFCFAD VREVQWLEVT LGFIVPFAII GLCYSLIVRA LIRAHRHRGL RPRRQKALRM IFAVVLVFFI CWLPENVFIS VHLLQWAQPG DTPCKQSFRH AYPLTGHIVN LAAFSNSCLS PLIYSFLGET FRDKLRLYVA QKTSLPALNR FCHATLKAVI PDSTEQSDVK FSSAV. It is sometimes possible for the material contained within the vial of "G-protein coupled estrogen receptor 1 (Gper), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.