Protein GMH1 (GMH1) Recombinant Protein | GMH1 recombinant protein
Recombinant Saccharomyces cerevisiae Protein GMH1 (GMH1)
Gene Names
GMH1; MSG1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein GMH1 (GMH1); Recombinant Saccharomyces cerevisiae Protein GMH1 (GMH1); GMH1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-273
Sequence
MSYLPTYSNDLPAGPQGQRRRNNGNENDARQGYGQQSVPMVIRRLFKTPKNLDLETASWEMFHLIFHPRKAYRSIYYQRQTKNQWARDDPSFFIFQIALISLSSIIWSIYNSGFNNDSDMGALSIIGHFFKSLVMMVILDFFIFGFIMATIFYLLLNRSHFKFKSSQNSVVEWAYCFDVHCNSFLIILLCLYFIQFLLLPIINLQNWISLLIGNSLYCFAIGHYFILTFYGYNQLPFLKNLNFILLPTLGLSIIYLISLFGIDLSKKLSFYNY
Sequence Length
273
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for GMH1 recombinant protein
GMH1; MSG1
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,993 Da
NCBI Official Full Name
Gmh1p
NCBI Official Symbol
GMH1
NCBI Official Synonym Symbols
MSG1
NCBI Protein Information
Gmh1p
UniProt Protein Name
Protein GMH1
Protein Family
UniProt Gene Name
GMH1
UniProt Synonym Gene Names
MSG1
UniProt Entry Name
GMH1_YEAST
Uniprot Description
Subunit structure: Interacts with GEA1 and GEA2. Ref.3
Subcellular location: Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Note: Recycles between Golgi apparatus and endoplasmic reticulum. Ref.3
Sequence similarities: Belongs to the unc-50 family.
Similar Products
Product Notes
The GMH1 gmh1 (Catalog #AAA1138857) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-273. The amino acid sequence is listed below: MSYLPTYSND LPAGPQGQRR RNNGNENDAR QGYGQQSVPM VIRRLFKTPK NLDLETASWE MFHLIFHPRK AYRSIYYQRQ TKNQWARDDP SFFIFQIALI SLSSIIWSIY NSGFNNDSDM GALSIIGHFF KSLVMMVILD FFIFGFIMAT IFYLLLNRSH FKFKSSQNSV VEWAYCFDVH CNSFLIILLC LYFIQFLLLP IINLQNWISL LIGNSLYCFA IGHYFILTFY GYNQLPFLKN LNFILLPTLG LSIIYLISLF GIDLSKKLSF YNY. It is sometimes possible for the material contained within the vial of "Protein GMH1 (GMH1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
