Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Gamma-glutamyltransferase light chain 1 (GGTLC1) Recombinant Protein | GGTLC1 recombinant protein

Recombinant Human Gamma-glutamyltransferase light chain 1 (GGTLC1)

Gene Names
GGTLC1; GGTL6; GGTLA3; GGTLA4; dJ831C21.1; dJ831C21.2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gamma-glutamyltransferase light chain 1 (GGTLC1); Recombinant Human Gamma-glutamyltransferase light chain 1 (GGTLC1); GGTLC1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-225, Full length protein
Sequence
MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
Sequence Length
225
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GGTLC1 recombinant protein
This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. In contrast, the product of this gene only contains homology to the light chain region, and lacks a transmembrane domain. Multiple alternatively spliced variants, encoding the same protein, have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,274 Da
NCBI Official Full Name
glutathione hydrolase light chain 1
NCBI Official Synonym Full Names
gamma-glutamyltransferase light chain 1
NCBI Official Symbol
GGTLC1
NCBI Official Synonym Symbols
GGTL6; GGTLA3; GGTLA4; dJ831C21.1; dJ831C21.2
NCBI Protein Information
glutathione hydrolase light chain 1; gamma-glutamyltransferase light chain 1
UniProt Protein Name
Glutathione hydrolase light chain 1
Protein Family
UniProt Gene Name
GGTLC1
UniProt Synonym Gene Names
GGTLA4

NCBI Description

This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. In contrast, the product of this gene only contains homology to the light chain region, and lacks a transmembrane domain. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Oct 2008]

Uniprot Description

MiscellaneousCorresponds to the light chain of other gamma-glutamyltransferase family members. Has no catalytic activity.

Similar Products

Product Notes

The GGTLC1 ggtlc1 (Catalog #AAA1456745) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-225, Full length protein. The amino acid sequence is listed below: MTSEFFSAQL RAQISDDTTH PISYYKPEFY MPDDGGTAHL SVVAEDGSAV SATSTINLYF GSKVRSPVSG ILLNNEMDDF SSTSITNEFG VPPSPANFIQ PGKQPLSSMC PTIMVGQDGQ VRMVVGAAGG TQITMATALA IIYNLWFGYD VKWAVEEPRL HNQLLPNVTT VERNIDQEVT AALETRHHHT QITSTFIAVV QAIVRMAGGW AAASDSRKGG EPAGY. It is sometimes possible for the material contained within the vial of "Gamma-glutamyltransferase light chain 1 (GGTLC1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.